Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06067
Gene name
Locationscaffold_07:900545..901510
Strand+
Gene length (bp)965
Transcript length (bp)546
Coding sequence length (bp)546
Protein length (aa) 182

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04161 Arv1 Arv1-like family 3.2E-46 3 138
PF04161 Arv1 Arv1-like family 1.9E-08 133 171

GO

GO Term Description Terminal node
GO:0032366 intracellular sterol transport Yes
GO:0015918 sterol transport No
GO:0051641 cellular localization No
GO:0051179 localization No
GO:0046907 intracellular transport No
GO:0071702 organic substance transport No
GO:0015850 organic hydroxy compound transport No
GO:0006869 lipid transport No
GO:0008150 biological_process No
GO:0051649 establishment of localization in cell No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0032365 intracellular lipid transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 132 154 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06067
MPICIECRHYVKTLWTKYSGAGDQSSGHNIRLTVCRQCGRFCDKYVEHDFIVLFIDLVLIKPQVYRHLLHNTLMR
ELDGFDPSIIRLGVLLLLFDVYLTWARIEKQTVPTASPSESNLGRLARQPIVLQYMFFLLLSLLVSSSTKLFPIL
MVIWEYDVPAAARSLGWALLLVQHPDGLWAD*
Coding >Ophcf2|06067
ATGCCTATCTGTATTGAATGTCGACATTATGTGAAGACTCTCTGGACCAAGTACTCCGGTGCTGGTGACCAGTCA
TCCGGCCACAACATTCGATTGACTGTTTGCCGACAATGTGGTCGGTTCTGCGACAAATACGTGGAGCACGACTTC
ATCGTCTTGTTCATTGACCTTGTGTTGATCAAGCCGCAAGTCTACCGCCATCTTCTACACAACACCCTCATGCGC
GAATTGGATGGCTTTGATCCGTCAATCATACGTCTTGGGGTTTTACTACTACTTTTCGATGTCTACCTCACGTGG
GCTCGCATTGAGAAGCAGACAGTACCCACTGCGTCTCCTAGCGAAAGCAACCTGGGTCGACTTGCGCGTCAGCCA
ATTGTGTTGCAGTATATGTTCTTTTTGCTGCTGTCCCTGCTTGTCTCGTCCTCTACCAAACTTTTCCCCATTTTG
ATGGTCATCTGGGAATATGACGTCCCCGCCGCCGCACGATCACTGGGCTGGGCGCTTTTGCTGGTGCAGCATCCC
GATGGGCTATGGGCCGATTAG
Transcript >Ophcf2|06067
ATGCCTATCTGTATTGAATGTCGACATTATGTGAAGACTCTCTGGACCAAGTACTCCGGTGCTGGTGACCAGTCA
TCCGGCCACAACATTCGATTGACTGTTTGCCGACAATGTGGTCGGTTCTGCGACAAATACGTGGAGCACGACTTC
ATCGTCTTGTTCATTGACCTTGTGTTGATCAAGCCGCAAGTCTACCGCCATCTTCTACACAACACCCTCATGCGC
GAATTGGATGGCTTTGATCCGTCAATCATACGTCTTGGGGTTTTACTACTACTTTTCGATGTCTACCTCACGTGG
GCTCGCATTGAGAAGCAGACAGTACCCACTGCGTCTCCTAGCGAAAGCAACCTGGGTCGACTTGCGCGTCAGCCA
ATTGTGTTGCAGTATATGTTCTTTTTGCTGCTGTCCCTGCTTGTCTCGTCCTCTACCAAACTTTTCCCCATTTTG
ATGGTCATCTGGGAATATGACGTCCCCGCCGCCGCACGATCACTGGGCTGGGCGCTTTTGCTGGTGCAGCATCCC
GATGGGCTATGGGCCGATTAG
Gene >Ophcf2|06067
ATGCCTATCTGTATTGAATGTCGACATTATGTGAAGACTCTCTGGACCAAGTACTCCGGTGCTGGTGACCAGTCA
TCCGGCCACAACATTCGATTGACTGTTTGCCGACAATGTGGTCGGTTCTGCGACAAATACGTGGAGCACGACTTC
ATCGTCTTGTTCATTGACCTTGTGTTGATCAAGCCGCAAGCATGTTGCCTCTCTAGCGATTTTTTGAAGACTGCT
GATGTTCTAACTCCTCGTTGAAGGTCTACCGCCATCTTCTACACAACACCCTCATGCGCGAATTGGATGGCTTTG
ATGTAAGTTACTTCACTACATGCGCGATCCGACAAATCTTCCACTTTCATACCCTCTTGTCAAACATTCCAGGCA
CCAACTGTCTTCTGACCGAAGTTTCCCGAGGCGGTAGCCGTCAATCATACGTCTTGGGGTTTTACTACTACTTTT
CGATGTCTACCTCACGTGGGCTCGCATTGAGAAGCAGACAGTACCCACTGCGTCTCCTAGCGAAAGCAACCTGGG
TCGACTTGCGCGTCAGCCAATTGTGTTGCAGTATATGTTCTTTTGTCAGTCTTCGTCATAGGTATTGCATAGGAT
ATTCATGTTCATCACTCACTACTTGATAGTGCTGCTGTGTACGCTCTCGACCACGGCTTTTCACGTCAGCATTCG
TTTCTTGGCATCTTCACCATATTCGCCACTACTCTCTTTGGGTATAATGGCTCGACGAACGAGACCCAATTCTAT
TTCGACAGCCCTGCTTGTCTCGTCCTCTACCAAACTTTTCCCCATTTTGATGGTCATCTGGGAATATGACGTCCC
CGCCGCCGCACGATCACTGGGCTGGGCGGTAGTAGCAAATAATGTCGAGGCGTTGCGAATTCTCCTAGACTGCAG
ATATCACACAGCTTGCATACTAGCTTTTGCTGGTGCAGCATCCCGATGGGCTATGGGCCGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail