Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06055
Gene name
Locationscaffold_07:521115..522768
Strand+
Gene length (bp)1653
Transcript length (bp)1392
Coding sequence length (bp)1392
Protein length (aa) 464

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01134 GIDA Glucose inhibited division protein A 3.5E-151 34 414
PF13932 GIDA_C tRNA modifying enzyme MnmG/GidA C-terminal domain 2.0E-13 415 440
PF12831 FAD_oxidored FAD dependent oxidoreductase 2.2E-07 34 182

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1666 0.1468 0.0875 0.0466 0.8744 0.079 0.0442 0.0367 0.0747 0.0762

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1901
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3457
Ophiocordyceps australis map64 (Brazil) OphauB2|2778
Ophiocordyceps camponoti-floridani Ophcf2|06055 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3322
Ophiocordyceps kimflemingae Ophio5|6802
Ophiocordyceps subramaniannii Hirsu2|1982

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06055
MPVLAWSKRLWLYPKLSLGRRYFAQETCQPRPFDVIVVGGGHAGAEASAAAARAGARTALITPKIDNLGTCSCNP
SFGGIGKGTIVREIDALDGLVGKVVDESGVQFHVLNRKKGPAVWGPRAQIDRKLFMKYMREELERQPNLSLVTGT
VSDLVLEGGKIPIVSGVRLDTGHVLSATRVIITTGTFLRGEIHIGLQTYPAGRVGEAATFGLSDSLQSAGFRLGR
LKTGTPPRLDRESIDFGPLLAKGGDDPPLPFSYLHNAVKVEKQLSCHVTYTNEATHDIIRQNLDKTIHIRETIKG
PRYCPSLESKVITFATRDRHIVWLEPEGFDSPVVYPNGLSMTVPEDVQEQALRTIRGLENVRLLQPGYGVEYDYV
DPRGLKSTLETKFISGLYLAGQINGTTGYEEAAGQGIVADGYIGIMIDDLITKGVTEPYRMFTSRKNGASSRTSA
GIYFATSGSRWLI*
Coding >Ophcf2|06055
ATGCCAGTACTTGCGTGGTCGAAACGGCTCTGGCTCTATCCGAAGCTATCTCTGGGAAGGCGATACTTCGCCCAG
GAGACATGTCAGCCTCGACCATTCGATGTCATCGTCGTCGGCGGAGGACATGCTGGAGCAGAGGCTTCTGCTGCT
GCTGCAAGGGCCGGGGCACGAACCGCACTCATTACGCCCAAAATCGATAACCTAGGGACATGCTCATGCAACCCC
AGTTTTGGAGGCATCGGCAAAGGCACCATAGTCCGCGAGATTGACGCTTTAGACGGACTCGTCGGAAAGGTCGTC
GATGAATCTGGCGTCCAATTTCACGTGTTGAATCGGAAAAAGGGTCCTGCTGTCTGGGGACCACGCGCTCAAATC
GACCGAAAGCTTTTCATGAAATACATGAGAGAAGAGCTCGAACGCCAACCAAATCTCTCGCTTGTTACGGGCACT
GTATCCGACCTCGTTCTCGAAGGCGGGAAAATACCCATCGTGTCCGGCGTGCGACTCGATACTGGACATGTGCTG
TCTGCAACGAGGGTTATCATTACTACGGGTACATTTTTGCGGGGAGAGATTCACATTGGCCTGCAGACCTATCCT
GCGGGTCGTGTTGGAGAGGCTGCCACCTTCGGCCTGAGCGATTCGCTACAAAGTGCTGGGTTTCGGTTGGGGCGG
TTGAAGACTGGTACACCGCCACGGCTCGACCGCGAATCCATCGACTTCGGGCCGCTACTGGCAAAGGGGGGGGAT
GATCCGCCTTTGCCGTTCAGTTATCTTCATAATGCTGTAAAGGTCGAGAAACAACTGTCCTGCCACGTGACGTAC
ACCAACGAGGCAACCCACGACATCATCCGCCAGAACCTTGACAAGACAATCCACATACGCGAAACTATCAAGGGG
CCGAGATACTGTCCATCGCTCGAGTCAAAAGTGATAACTTTCGCTACCAGAGATCGCCACATCGTCTGGCTCGAG
CCCGAAGGTTTCGACAGCCCCGTCGTGTACCCAAACGGCTTGTCGATGACTGTGCCCGAGGATGTTCAAGAGCAA
GCGCTCCGTACGATTCGAGGTCTTGAAAATGTCAGGCTATTGCAGCCAGGCTACGGGGTCGAGTACGACTATGTA
GACCCCAGAGGTCTCAAGAGTACGCTCGAGACAAAATTCATTTCAGGGCTTTACCTCGCCGGACAAATTAATGGC
ACAACTGGATATGAGGAAGCTGCTGGACAGGGCATCGTTGCAGACGGCTACATCGGCATCATGATCGACGACTTG
ATAACAAAGGGTGTGACCGAGCCTTACAGAATGTTCACGTCTCGAAAGAATGGGGCGTCGTCACGGACAAGCGCT
GGAATATATTTTGCGACGAGCGGCAGCAGATGGCTGATATGA
Transcript >Ophcf2|06055
ATGCCAGTACTTGCGTGGTCGAAACGGCTCTGGCTCTATCCGAAGCTATCTCTGGGAAGGCGATACTTCGCCCAG
GAGACATGTCAGCCTCGACCATTCGATGTCATCGTCGTCGGCGGAGGACATGCTGGAGCAGAGGCTTCTGCTGCT
GCTGCAAGGGCCGGGGCACGAACCGCACTCATTACGCCCAAAATCGATAACCTAGGGACATGCTCATGCAACCCC
AGTTTTGGAGGCATCGGCAAAGGCACCATAGTCCGCGAGATTGACGCTTTAGACGGACTCGTCGGAAAGGTCGTC
GATGAATCTGGCGTCCAATTTCACGTGTTGAATCGGAAAAAGGGTCCTGCTGTCTGGGGACCACGCGCTCAAATC
GACCGAAAGCTTTTCATGAAATACATGAGAGAAGAGCTCGAACGCCAACCAAATCTCTCGCTTGTTACGGGCACT
GTATCCGACCTCGTTCTCGAAGGCGGGAAAATACCCATCGTGTCCGGCGTGCGACTCGATACTGGACATGTGCTG
TCTGCAACGAGGGTTATCATTACTACGGGTACATTTTTGCGGGGAGAGATTCACATTGGCCTGCAGACCTATCCT
GCGGGTCGTGTTGGAGAGGCTGCCACCTTCGGCCTGAGCGATTCGCTACAAAGTGCTGGGTTTCGGTTGGGGCGG
TTGAAGACTGGTACACCGCCACGGCTCGACCGCGAATCCATCGACTTCGGGCCGCTACTGGCAAAGGGGGGGGAT
GATCCGCCTTTGCCGTTCAGTTATCTTCATAATGCTGTAAAGGTCGAGAAACAACTGTCCTGCCACGTGACGTAC
ACCAACGAGGCAACCCACGACATCATCCGCCAGAACCTTGACAAGACAATCCACATACGCGAAACTATCAAGGGG
CCGAGATACTGTCCATCGCTCGAGTCAAAAGTGATAACTTTCGCTACCAGAGATCGCCACATCGTCTGGCTCGAG
CCCGAAGGTTTCGACAGCCCCGTCGTGTACCCAAACGGCTTGTCGATGACTGTGCCCGAGGATGTTCAAGAGCAA
GCGCTCCGTACGATTCGAGGTCTTGAAAATGTCAGGCTATTGCAGCCAGGCTACGGGGTCGAGTACGACTATGTA
GACCCCAGAGGTCTCAAGAGTACGCTCGAGACAAAATTCATTTCAGGGCTTTACCTCGCCGGACAAATTAATGGC
ACAACTGGATATGAGGAAGCTGCTGGACAGGGCATCGTTGCAGACGGCTACATCGGCATCATGATCGACGACTTG
ATAACAAAGGGTGTGACCGAGCCTTACAGAATGTTCACGTCTCGAAAGAATGGGGCGTCGTCACGGACAAGCGCT
GGAATATATTTTGCGACGAGCGGCAGCAGATGGCTGATATGA
Gene >Ophcf2|06055
ATGCCAGTACTTGCGTGGTCGAAACGGCTCTGGCTCTATCCGAAGCTATCTCTGGGAAGGCGATACTTCGCCCAG
GAGACATGTCAGCCTCGGTAAGAATCTGATCATGACGTGCGCTCCGGCTCCCATGTTCTAAACCTTAGCAAGACC
ATTCGATGTCATCGTCGTCGGCGGAGGACATGCTGGAGCAGAGGCTTCTGCTGCTGCTGCAAGGGCCGGGGCACG
AACCGCACTCATTACGCCCAAAATCGATAACCTAGGGACATGCTCATGCAACCCCAGTTTTGGAGGCATCGGCAA
AGGCACCATAGTCCGCGAGATTGACGCTTTAGACGGACTCGTCGGAAAGGTCGTCGATGAATCTGGCGTCCAATT
TCACGTGTTGAATCGGAAAAAGGGTCCTGCTGTCTGGGTAAGTGCTTTCATGCTCCATCAACGCTTCCAAGGCTT
TCTACACCCGGCCCTGCACCCGTTTCGAAGTCTGATTCCAAATGGATCAGGGACCACGCGCTCAAATCGACCGAA
AGCTTTTCATGAAATACATGAGAGAAGAGCTCGAACGCCAACCAAATCTCTCGCTTGTTACGGGCACTGTATCCG
ACCTCGTTCTCGAAGGCGGGAAAATACCCATCGTGTCCGGCGTGCGACTCGATACTGGACATGTGCTGTCTGCAA
CGAGGGTTATCATTACTACGGGTACATTTTTGCGGGGAGAGATTCACATTGGCCTGCAGACCTATCCTGCGGGTC
GTGTTGGAGAGGCTGCCACCTTCGGCCTGAGCGATTCGCTACAAAGTGCTGGGTTTCGGTTGGGGCGGTTGAAGA
CTGGTACACCGCCACGGCTCGACCGCGAATCCATCGACTTCGGGCCGCTACTGGCAAAGGGGGGGGATGATCCGC
CTTTGCCGTTCAGTTATCTTCATAATGCTGTAAAGGTCGAGAAACAACTGTCCTGCCACGTGACGTACACCAACG
AGGCAACCCACGACATCATCCGCCAGAACCTTGACAAGACAATCCACATACGCGAAACTATCAAGGGGCCGAGAT
ACTGTCCATCGCTCGAGTCAAAAGTGATAACTTTCGCTACCAGAGATCGCCACATCGTCTGGCTCGAGCCCGAAG
GTTTCGACAGCCCCGTCGTGTACCCAAACGGCTTGTCGATGACTGTGCCCGAGGATGTTCAAGAGCAAGCGCTCC
GTACGATTCGAGGTCTTGAAAATGTCAGGCTATTGCAGCCAGGCTACGGGGTCGAGTACGACTATGTAGACCCCA
GAGGTCTCAAGAGTACGCTCGAGACAAAATTCATTTCAGGGCTTTACCTCGCCGGACAAATTAATGGCACAACTG
GATATGAGGAAGCTGCTGGACAGGGCATCGTTGCAGGTATCAACGCGGGAAGGGCATCTTTGGGCCTTTCCCCAG
TTTCCATATCCCGATCAGACGGCTACATCGGCATCATGATCGACGACTTGATAACAAAGGGTGTGACCGAGCCTT
ACAGAATGTTCACGTCTCGAAGTGAATTTCGCTTGGCCGCGAGGGCCGATAATGCCGATACTCGGCTGACGGAAA
AGGGTAGAGAATGGGGCGTCGTCACGGACAAGCGCTGGAATATATTTTGCGACGAGCGGCAGCAGATGGCTGATA
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail