Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06053
Gene name
Locationscaffold_07:513872..515751
Strand+
Gene length (bp)1879
Transcript length (bp)1614
Coding sequence length (bp)1614
Protein length (aa) 538

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 4.4E-54 121 432

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 51 73 22
2 93 112 19
3 276 298 22
4 368 390 22
5 423 445 22
6 449 471 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06053
MLQVLHRPFEALAPMVGASPDEIKIIVSFLLSYPLAGVLKRIPDPRPGYKNLFIIGISIFYMVGLFDLWRGLGTL
LFSAAGAYGIANYLQKNPYMPWIGFVFLMCHMSFNHIRRQISNDPTTVDITGAQMVLVMKLSAFCWNVADGQLPA
EHLTDHQKDRALSAPPSLLDYAGYVLFFPSLFAGPAFDYVEYRRWIDTSMFDVPADVDSAKRPPVRKKRKIPRSG
TPATIKAIQGLCWIGLFVSLSSRFGYEQLVDESYMQHGLLRRIWIMYMANFVARLKYYGVWSLTEGSCILAGLGY
NGVDPVTGKVSWNRLQNISPWLVETAQNPREYMAGWNINTNNWLRNYVYLRVTPRGKKPGFRASMTTFATSALWH
GFYPGYYLSFVLASLIQTAAKNFRRLVRPFFLDPVTGEARSSKKYYDAMSYIATQTTFAFVATPFLLLSLKDSIR
AWSCVYYYGLVWTIACMVFFASPCKGMLKAKLENGHAQNNPKLLRSLSTESLKEPILGISKDLEQDVGEAVEEIK
AEVRARQRKMSR*
Coding >Ophcf2|06053
ATGCTTCAGGTGTTGCACAGGCCTTTTGAGGCCCTTGCGCCCATGGTTGGGGCGTCTCCGGATGAGATTAAAATC
ATAGTCTCTTTTCTCTTGTCCTATCCTCTGGCCGGCGTTTTAAAGCGTATTCCAGACCCTAGACCTGGATACAAG
AACCTCTTCATCATTGGCATATCCATCTTTTACATGGTTGGTCTCTTCGACCTCTGGCGCGGCTTGGGAACATTA
CTCTTCAGCGCGGCCGGCGCATACGGAATCGCAAACTATCTACAAAAGAACCCGTACATGCCATGGATCGGCTTC
GTCTTCCTCATGTGCCACATGTCTTTTAATCACATCCGGCGGCAGATCTCTAACGACCCGACGACGGTGGACATC
ACCGGAGCGCAAATGGTCCTGGTGATGAAGCTGAGCGCATTCTGCTGGAACGTTGCCGATGGTCAGCTCCCGGCG
GAGCACCTGACGGATCACCAGAAAGATCGCGCTCTTTCGGCACCGCCGTCGCTGCTCGACTACGCTGGATATGTT
CTCTTCTTTCCGAGTCTGTTCGCTGGCCCGGCTTTCGATTACGTCGAGTACCGTCGTTGGATCGACACTTCCATG
TTCGATGTCCCCGCCGATGTCGATAGTGCCAAAAGACCTCCCGTTAGGAAGAAGCGCAAGATCCCACGGAGCGGT
ACCCCCGCCACTATCAAGGCCATACAGGGCCTCTGTTGGATCGGCCTGTTCGTCTCGTTGTCCTCGCGCTTTGGC
TATGAGCAGCTAGTGGACGAGTCGTACATGCAGCATGGCCTGTTGCGGCGCATCTGGATCATGTACATGGCAAAT
TTCGTCGCCAGGCTCAAGTACTACGGTGTCTGGTCCTTGACCGAGGGATCGTGCATCCTCGCCGGCCTCGGCTAT
AATGGTGTTGATCCCGTCACCGGTAAAGTCTCGTGGAATCGGTTGCAGAACATCAGTCCTTGGCTGGTGGAGACT
GCCCAGAACCCGCGAGAGTACATGGCTGGATGGAACATTAACACAAACAATTGGCTCAGGAACTACGTCTATCTT
CGTGTCACGCCAAGGGGCAAGAAGCCGGGCTTTCGCGCGAGCATGACCACGTTTGCAACCAGCGCCCTCTGGCAC
GGCTTTTACCCCGGCTACTACCTGTCCTTTGTTCTCGCCAGTCTGATACAGACAGCTGCCAAGAATTTCCGCCGC
CTCGTCCGCCCTTTCTTCCTCGATCCCGTCACGGGCGAAGCTAGGTCGAGCAAAAAGTACTACGACGCAATGAGC
TACATCGCCACGCAAACGACCTTTGCCTTCGTCGCCACGCCCTTCCTCCTGCTATCCTTGAAGGACTCCATCCGC
GCTTGGTCGTGCGTGTACTATTACGGTCTCGTCTGGACCATCGCATGCATGGTCTTCTTCGCCTCGCCATGCAAG
GGCATGCTCAAGGCCAAGTTGGAGAATGGCCATGCGCAGAATAATCCGAAGCTGTTGCGGTCCCTCAGCACCGAA
AGTCTTAAAGAACCCATTCTCGGTATATCGAAAGATCTCGAACAGGACGTGGGCGAAGCTGTGGAGGAGATCAAG
GCTGAAGTTCGGGCGCGGCAAAGGAAGATGTCGCGATGA
Transcript >Ophcf2|06053
ATGCTTCAGGTGTTGCACAGGCCTTTTGAGGCCCTTGCGCCCATGGTTGGGGCGTCTCCGGATGAGATTAAAATC
ATAGTCTCTTTTCTCTTGTCCTATCCTCTGGCCGGCGTTTTAAAGCGTATTCCAGACCCTAGACCTGGATACAAG
AACCTCTTCATCATTGGCATATCCATCTTTTACATGGTTGGTCTCTTCGACCTCTGGCGCGGCTTGGGAACATTA
CTCTTCAGCGCGGCCGGCGCATACGGAATCGCAAACTATCTACAAAAGAACCCGTACATGCCATGGATCGGCTTC
GTCTTCCTCATGTGCCACATGTCTTTTAATCACATCCGGCGGCAGATCTCTAACGACCCGACGACGGTGGACATC
ACCGGAGCGCAAATGGTCCTGGTGATGAAGCTGAGCGCATTCTGCTGGAACGTTGCCGATGGTCAGCTCCCGGCG
GAGCACCTGACGGATCACCAGAAAGATCGCGCTCTTTCGGCACCGCCGTCGCTGCTCGACTACGCTGGATATGTT
CTCTTCTTTCCGAGTCTGTTCGCTGGCCCGGCTTTCGATTACGTCGAGTACCGTCGTTGGATCGACACTTCCATG
TTCGATGTCCCCGCCGATGTCGATAGTGCCAAAAGACCTCCCGTTAGGAAGAAGCGCAAGATCCCACGGAGCGGT
ACCCCCGCCACTATCAAGGCCATACAGGGCCTCTGTTGGATCGGCCTGTTCGTCTCGTTGTCCTCGCGCTTTGGC
TATGAGCAGCTAGTGGACGAGTCGTACATGCAGCATGGCCTGTTGCGGCGCATCTGGATCATGTACATGGCAAAT
TTCGTCGCCAGGCTCAAGTACTACGGTGTCTGGTCCTTGACCGAGGGATCGTGCATCCTCGCCGGCCTCGGCTAT
AATGGTGTTGATCCCGTCACCGGTAAAGTCTCGTGGAATCGGTTGCAGAACATCAGTCCTTGGCTGGTGGAGACT
GCCCAGAACCCGCGAGAGTACATGGCTGGATGGAACATTAACACAAACAATTGGCTCAGGAACTACGTCTATCTT
CGTGTCACGCCAAGGGGCAAGAAGCCGGGCTTTCGCGCGAGCATGACCACGTTTGCAACCAGCGCCCTCTGGCAC
GGCTTTTACCCCGGCTACTACCTGTCCTTTGTTCTCGCCAGTCTGATACAGACAGCTGCCAAGAATTTCCGCCGC
CTCGTCCGCCCTTTCTTCCTCGATCCCGTCACGGGCGAAGCTAGGTCGAGCAAAAAGTACTACGACGCAATGAGC
TACATCGCCACGCAAACGACCTTTGCCTTCGTCGCCACGCCCTTCCTCCTGCTATCCTTGAAGGACTCCATCCGC
GCTTGGTCGTGCGTGTACTATTACGGTCTCGTCTGGACCATCGCATGCATGGTCTTCTTCGCCTCGCCATGCAAG
GGCATGCTCAAGGCCAAGTTGGAGAATGGCCATGCGCAGAATAATCCGAAGCTGTTGCGGTCCCTCAGCACCGAA
AGTCTTAAAGAACCCATTCTCGGTATATCGAAAGATCTCGAACAGGACGTGGGCGAAGCTGTGGAGGAGATCAAG
GCTGAAGTTCGGGCGCGGCAAAGGAAGATGTCGCGATGA
Gene >Ophcf2|06053
ATGCTTCAGGTGTTGCACAGGCGTCAGTTTGGTCGAATCTCCGCTCGACTTGCGAGTTGCTGATGATGGGTGTAG
CTTTTGAGGCCCTTGCGCCCATGGTTGGGGCGTCTCCGGATGAGAGTGAGTCGCGCGCCCTTTCCTTCTCTTGGC
GTTGCGATGCGCTTGCACTCTACTGACAAGACGCTCGTCGTCCTACCAGTTAAAATCATAGTCTCTTTTCTCTTG
TCCTATCCTCTGGCCGGCGTTTTAAAGCGTATTCCAGACCCTAGACCTGGATACAAGAACCTCTTCATCATTGGG
TACGCCTCGTCTTCCCTTGTTGTCGTTGCCTGTGGTACCTTCTGACCTGATTTGCGTGGACAGCATATCCATCTT
TTACATGGTTGGTCTCTTCGACCTCTGGCGCGGCTTGGGAACATTACTCTTCAGCGCGGCCGGCGCATACGGAAT
CGCAAACTATCTACAAAAGAACCCGTACATGCCATGGATCGGCTTCGTCTTCCTCATGTGCCACATGTCTTTTAA
TCACATCCGGCGGCAGATCTCTAACGACCCGACGACGGTGGACATCACCGGAGCGCAAATGGTCCTGGTGATGAA
GCTGAGCGCATTCTGCTGGAACGTTGCCGATGGTCAGCTCCCGGCGGAGCACCTGACGGATCACCAGAAAGATCG
CGCTCTTTCGGCACCGCCGTCGCTGCTCGACTACGCTGGATATGTTCTCTTCTTTCCGAGTCTGTTCGCTGGCCC
GGCTTTCGATTACGTCGAGTACCGTCGTTGGATCGACACTTCCATGTTCGATGTCCCCGCCGATGTCGATAGTGC
CAAAAGACCTCCCGTTAGGAAGAAGCGCAAGATCCCACGGAGCGGTACCCCCGCCACTATCAAGGCCATACAGGG
CCTCTGTTGGATCGGCCTGTTCGTCTCGTTGTCCTCGCGCTTTGGCTATGAGCAGCTAGTGGACGAGTCGTACAT
GCAGCATGGCCTGTTGCGGCGCATCTGGATCATGTACATGGCAAATTTCGTCGCCAGGCTCAAGTACTACGGTGT
CTGGTCCTTGACCGAGGGATCGTGCATCCTCGCCGGCCTCGGCTATAATGGTGTTGATCCCGTCACCGGTAAAGT
CTCGTGGAATCGGTTGCAGAACATCAGTCCTTGGCTGGTGGAGACTGCCCAGAACCCGCGAGAGTACATGGCTGG
ATGGAACATTAACACAAACAATTGGCTCAGGAACTACGTCTATCTTCGTGTCACGCCAAGGGGCAAGAAGCCGGG
CTTTCGCGCGAGCATGACCACGTTTGCAACCAGCGCCCTCTGGCACGGCTTTTACCCCGGCTACTACCTGTCCTT
TGTTCTCGCCAGTCTGATACAGACAGCTGCCAAGAGTAAGTCATCACGAGCTCGTAATTCGGCCGGCAAAGTTGG
TTGATTGCTGATGGATGATTGGCTCTTAGATTTCCGCCGCCTCGTCCGCCCTTTCTTCCTCGATCCCGTCACGGG
CGAAGCTAGGTCGAGCAAAAAGTACTACGACGCAATGAGCTACATCGCCACGCAAACGACCTTTGCCTTCGTCGC
CACGCCCTTCCTCCTGCTATCCTTGAAGGACTCCATCCGCGCTTGGTCGTGCGTGTACTATTACGGTCTCGTCTG
GACCATCGCATGCATGGTCTTCTTCGCCTCGCCATGCAAGGGCATGCTCAAGGCCAAGTTGGAGAATGGCCATGC
GCAGAATAATCCGAAGCTGTTGCGGTCCCTCAGCACCGAAAGTCTTAAAGAACCCATTCTCGGTATATCGAAAGA
TCTCGAACAGGACGTGGGCGAAGCTGTGGAGGAGATCAAGGCTGAAGTTCGGGCGCGGCAAAGGAAGATGTCGCG
ATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail