Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06050
Gene name
Locationscaffold_07:499996..501768
Strand-
Gene length (bp)1772
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 4.7E-14 23 93
PF01266 DAO FAD dependent oxidoreductase 3.5E-07 20 60
PF00890 FAD_binding_2 FAD binding domain 9.5E-07 21 59
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 6.0E-05 29 70

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 135 157 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06050
MPRKQSGRDEMDPLNSKAKHVVIVGGGAAGMSCAATLANHAHRFKVTVLEKSDVVGGQATSIPLDEQKYGAPWMN
NGVQGGSKIFKHTFNFFRQQGFPAQEVQLQVAFGKGDAGFWTNVFPSKLVQRYAADVKKFGFFLKLIKWTMPVLG
LVPISIMLRLLLFSKGFGDKMVYPLIALFLGTGNQTPNVPSAIVERLFDDPNMKLWDYDPVTLLPNLPTMFTFDH
LHAFYGAWKTDLEGKGVTFRNGTEVHEVLSRTKHGVKLRVGDVASGSSTEETFDDVVFCVLADDALRILGRQATW
REKLVLGGAAFYDDITVTHTDRAYFEKQYETTFKPELCAEPTSDFQKKQIAFAKGEGGSGSGGFRPMYYTFSYQQ
DPRLIEMSFNCSNYQHQLKKANEDAFGSRFEPVYQTIFLNKTLEHLWTIDDIDKSKVIKKNWWHQLGHRWQHYLR
VVPGMMFINGRNRTSFAGSWTLVNMHELACVSGIAAAYRLGADYQHFDDFAQDFFAKYLLLSHGMIFSRQEKQRR
*
Coding >Ophcf2|06050
ATGCCTCGGAAGCAGTCTGGGCGTGACGAAATGGATCCGCTTAACAGCAAGGCCAAGCATGTCGTGATAGTCGGC
GGAGGGGCCGCAGGCATGTCTTGCGCTGCGACGTTGGCAAATCATGCCCATCGCTTCAAAGTCACCGTCTTGGAG
AAGAGCGATGTTGTCGGGGGCCAGGCGACGTCCATCCCGCTGGACGAGCAAAAATACGGCGCGCCGTGGATGAAC
AACGGTGTCCAGGGCGGATCCAAAATATTCAAGCACACCTTCAACTTCTTCCGTCAGCAGGGCTTCCCGGCGCAG
GAGGTCCAGTTACAGGTGGCTTTTGGCAAAGGCGACGCCGGCTTCTGGACAAATGTATTCCCCAGCAAGCTCGTC
CAGCGCTACGCGGCCGATGTCAAAAAATTTGGCTTCTTTCTCAAGCTTATCAAATGGACCATGCCTGTCCTGGGC
CTCGTGCCCATATCGATCATGCTGCGTCTTCTCCTCTTCAGCAAGGGCTTTGGAGACAAGATGGTCTATCCTCTT
ATCGCCCTCTTTCTCGGCACCGGCAACCAAACCCCTAACGTGCCTTCGGCCATTGTCGAACGTCTCTTTGACGAT
CCCAACATGAAGCTCTGGGACTACGATCCCGTCACCTTGCTGCCAAACCTGCCCACCATGTTTACCTTTGACCAC
CTCCACGCCTTCTACGGCGCCTGGAAGACTGATTTGGAGGGCAAAGGTGTCACATTCCGCAATGGCACAGAAGTT
CATGAAGTCTTGTCGAGGACAAAGCACGGGGTCAAGCTCCGGGTCGGAGACGTAGCCTCGGGCAGCTCGACAGAG
GAAACTTTTGACGATGTCGTCTTCTGTGTGCTCGCTGACGATGCTCTCCGGATCCTGGGTCGCCAAGCAACGTGG
CGTGAAAAGCTGGTGCTCGGCGGTGCCGCATTCTATGACGATATCACAGTCACTCATACCGACCGGGCGTATTTT
GAAAAGCAATACGAGACGACCTTCAAGCCCGAATTGTGCGCGGAGCCGACGTCGGATTTCCAGAAGAAGCAGATT
GCCTTTGCCAAGGGTGAAGGAGGTTCAGGCTCGGGCGGCTTCCGGCCCATGTACTACACATTCTCTTACCAGCAG
GACCCCCGTTTGATCGAAATGTCGTTCAACTGTAGCAACTACCAGCACCAGCTGAAGAAGGCCAACGAAGACGCC
TTTGGTAGCAGGTTTGAGCCCGTCTACCAGACCATCTTTCTCAACAAGACGCTCGAACACTTGTGGACGATTGAC
GACATTGACAAGTCAAAGGTCATCAAGAAGAATTGGTGGCATCAGCTCGGTCACCGGTGGCAGCACTACCTCCGA
GTCGTCCCGGGCATGATGTTCATCAATGGGAGAAACCGGACTTCCTTTGCCGGATCCTGGACGCTGGTGAACATG
CACGAGCTGGCCTGCGTCAGTGGCATCGCCGCCGCCTACCGCCTGGGTGCCGATTACCAACATTTCGACGACTTT
GCGCAAGATTTCTTTGCAAAATACCTCTTGCTGTCGCACGGCATGATCTTTTCCCGGCAGGAGAAGCAAAGGCGT
TGA
Transcript >Ophcf2|06050
ATGCCTCGGAAGCAGTCTGGGCGTGACGAAATGGATCCGCTTAACAGCAAGGCCAAGCATGTCGTGATAGTCGGC
GGAGGGGCCGCAGGCATGTCTTGCGCTGCGACGTTGGCAAATCATGCCCATCGCTTCAAAGTCACCGTCTTGGAG
AAGAGCGATGTTGTCGGGGGCCAGGCGACGTCCATCCCGCTGGACGAGCAAAAATACGGCGCGCCGTGGATGAAC
AACGGTGTCCAGGGCGGATCCAAAATATTCAAGCACACCTTCAACTTCTTCCGTCAGCAGGGCTTCCCGGCGCAG
GAGGTCCAGTTACAGGTGGCTTTTGGCAAAGGCGACGCCGGCTTCTGGACAAATGTATTCCCCAGCAAGCTCGTC
CAGCGCTACGCGGCCGATGTCAAAAAATTTGGCTTCTTTCTCAAGCTTATCAAATGGACCATGCCTGTCCTGGGC
CTCGTGCCCATATCGATCATGCTGCGTCTTCTCCTCTTCAGCAAGGGCTTTGGAGACAAGATGGTCTATCCTCTT
ATCGCCCTCTTTCTCGGCACCGGCAACCAAACCCCTAACGTGCCTTCGGCCATTGTCGAACGTCTCTTTGACGAT
CCCAACATGAAGCTCTGGGACTACGATCCCGTCACCTTGCTGCCAAACCTGCCCACCATGTTTACCTTTGACCAC
CTCCACGCCTTCTACGGCGCCTGGAAGACTGATTTGGAGGGCAAAGGTGTCACATTCCGCAATGGCACAGAAGTT
CATGAAGTCTTGTCGAGGACAAAGCACGGGGTCAAGCTCCGGGTCGGAGACGTAGCCTCGGGCAGCTCGACAGAG
GAAACTTTTGACGATGTCGTCTTCTGTGTGCTCGCTGACGATGCTCTCCGGATCCTGGGTCGCCAAGCAACGTGG
CGTGAAAAGCTGGTGCTCGGCGGTGCCGCATTCTATGACGATATCACAGTCACTCATACCGACCGGGCGTATTTT
GAAAAGCAATACGAGACGACCTTCAAGCCCGAATTGTGCGCGGAGCCGACGTCGGATTTCCAGAAGAAGCAGATT
GCCTTTGCCAAGGGTGAAGGAGGTTCAGGCTCGGGCGGCTTCCGGCCCATGTACTACACATTCTCTTACCAGCAG
GACCCCCGTTTGATCGAAATGTCGTTCAACTGTAGCAACTACCAGCACCAGCTGAAGAAGGCCAACGAAGACGCC
TTTGGTAGCAGGTTTGAGCCCGTCTACCAGACCATCTTTCTCAACAAGACGCTCGAACACTTGTGGACGATTGAC
GACATTGACAAGTCAAAGGTCATCAAGAAGAATTGGTGGCATCAGCTCGGTCACCGGTGGCAGCACTACCTCCGA
GTCGTCCCGGGCATGATGTTCATCAATGGGAGAAACCGGACTTCCTTTGCCGGATCCTGGACGCTGGTGAACATG
CACGAGCTGGCCTGCGTCAGTGGCATCGCCGCCGCCTACCGCCTGGGTGCCGATTACCAACATTTCGACGACTTT
GCGCAAGATTTCTTTGCAAAATACCTCTTGCTGTCGCACGGCATGATCTTTTCCCGGCAGGAGAAGCAAAGGCGT
TGA
Gene >Ophcf2|06050
ATGCCTCGGAAGCAGTCTGGGCGTGACGAAATGGATCCGCTTAACAGCAAGGCCAAGCATGTCGTGATAGTCGGC
GGAGGGGCCGCAGGCATGGTGGGATCCGACCACTCCACTCTCACAGGAACCCTCTGTCGTCGTCCGACAATGACT
GACCTACCTAACCTATAGTCTTGCGCTGCGACGTTGGCAAATCATGCCCATCGCTTCAAAGTCACCGTCTTGGAG
AAGAGCGATGTTGTCGGGGGCCAGGCGACGTCCATCCCGCTGGACGAGCAAAAATACGGCGCGCCGTGGATGAAC
AACGGTGTCCAGGGCGGATCCAAAGTCAGCCCCCCCCCCTTTCTCCCAGCTCTTTTCGCGCCGTTGACGAGGCAT
ACCGCAGATATTCAAGCACACCTTCAACTTCTTCCGTCAGCAGGGCTTCCCGGCGCAGGAGGTCCAGTTACAGGT
GGCTTTTGGCAAAGGCGACGCCGGCTTCTGGACAAATGTATTCCCCAGCAAGCTCGTCCAGCGCTACGCGGCCGA
TGTCAAAAAATTTGGCTTCTTTCTCAAGCTTATCAAATGGACCATGCCTGTCCTGGGCCTCGTGCCCATATCGAT
CATGCTGCGTCTTCTCCTCTTCAGCAAGGGCTTTGGAGACAAGATGGTCTATCCTCTTATCGCCCTCTTTCTCGG
CACCGGCAACCAAACCCCTAACGTGCCTTCGGCCATTGTCGAACGTCTCTTTGACGATCCCAACATGAAGCTCTG
GGACTACGATCCCGTCACCTTGCTGCCAAACCTGCCCACCATGTTTACCTTTGACCACCTCCACGCCTTCTACGG
CGCCTGGAAGACTGATTTGGAGGGCAAAGGTGTCACATTCCGCAATGGCACAGAAGTTCATGAAGTCTTGTCGAG
GACAAAGCACGGGGTCAAGCTCCGGGTCGGAGACGTAGCCTCGGGCAGCTCGACAGAGGAAACTTTTGACGATGT
CGTCTTCTGTGTGCTCGCTGACGATGCTCTCCGGATCCTGGGTCGCCAAGCAACGTGGCGTGAAAAGCTGGTGCT
CGGCGGTGCCGCATTCTATGACGATATCACAGTCACTCATACCGACCGGGCGTATTTTGAAAAGCAATACGAGAC
GACCTTCAAGCCCGAATTGTGCGCGGAGCCGACGTCGGATTTCCAGAAGAAGCAGATTGCCTTTGCCAAGGGTGA
AGGAGGTTCAGGCTCGGGCGGCTTCCGGCCCATGTACTACACATTCTCTTACCAGCAGGACCCCCGTTTGATCGA
AATGTCGTTCAACTGTAGCAACTACCAGCACCAGCTGAAGAAGGCCAACGAAGACGCCTTTGGTAGCAGGTTTGA
GCCCGTCTACCAGACCATCTTTCTCAACAAGACGCTCGAACACTTGTGGACGATTGACGACATTGACAAGTCAAA
GGTCATCAAGAAGAATTGGTGGCATCAGCTCGGTCACCGGTGGCAGCACTACCTCCGAGTCGTCCCGGGCATGAT
GTTCATCAATGGGAGAAACCGGACTTCCTTTGCCGGATCCTGGACGCTGGTGGTAAGACTGCCGACTCGATGCCT
ATGACAACGAAGGGAAAGGCTTACACACGAGCGTCTAGAACATGCACGAGCTGGCCTGCGTCAGTGGCATCGCCG
CCGCCTACCGCCTGGGTGCCGATTACCAACATTTCGACGACTTTGCGCAAGATTTCTTTGCAAAATACCTCTTGC
TGTCGCACGGCATGATCTTTTCCCGGCAGGAGAAGCAAAGGCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail