Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06047
Gene name
Locationscaffold_07:494053..494434
Strand+
Gene length (bp)381
Transcript length (bp)270
Coding sequence length (bp)270
Protein length (aa) 90

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06645 SPC12 Microsomal signal peptidase 12 kDa subunit (SPC12) 3.5E-29 17 86

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006465 signal peptide processing Yes
GO:0005787 signal peptidase complex Yes
GO:0019538 protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0110165 cellular anatomical entity No
GO:1905368 peptidase complex No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0043170 macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0051604 protein maturation No
GO:0016485 protein processing No
GO:0006518 peptide metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0098796 membrane protein complex No
GO:0008150 biological_process No
GO:0006508 proteolysis No
GO:1902494 catalytic complex No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 27 46 19
2 53 75 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06047
MAEEVLDQLRHLVDGPIDFDGQRRAEGFATLLLAISGLLAFNIGYHYQDIQKAVYIGLGGTLLTFLVVVPPWPFY
NKNPVKWLPAGSGL*
Coding >Ophcf2|06047
ATGGCCGAAGAGGTTCTTGACCAGCTGCGTCATCTGGTAGACGGGCCCATCGACTTTGACGGTCAGCGGCGAGCT
GAAGGCTTCGCTACGCTTCTGCTTGCCATCTCCGGGCTCCTGGCCTTCAACATCGGTTACCACTATCAAGACATT
CAAAAGGCCGTCTACATTGGACTAGGAGGAACGCTGCTGACATTTCTTGTCGTGGTGCCGCCGTGGCCGTTCTAC
AACAAGAACCCCGTCAAATGGCTACCTGCCGGCTCCGGACTGTGA
Transcript >Ophcf2|06047
ATGGCCGAAGAGGTTCTTGACCAGCTGCGTCATCTGGTAGACGGGCCCATCGACTTTGACGGTCAGCGGCGAGCT
GAAGGCTTCGCTACGCTTCTGCTTGCCATCTCCGGGCTCCTGGCCTTCAACATCGGTTACCACTATCAAGACATT
CAAAAGGCCGTCTACATTGGACTAGGAGGAACGCTGCTGACATTTCTTGTCGTGGTGCCGCCGTGGCCGTTCTAC
AACAAGAACCCCGTCAAATGGCTACCTGCCGGCTCCGGACTGTGA
Gene >Ophcf2|06047
ATGGCCGAAGAGGTTCTTGACCAGCTGCGTCATCTGGTAGACGGGCCCATCGTACGGTTTCTATTGCTACCGCTT
TGCCGTCTTCCTTCTCTCTGATTCTCCCCAAAAAGGACTTTGACGGTCAGCGGCGAGCTGAAGGCTTCGCTACGC
TTCTGCTTGCCATCTCCGGGGTACGGTTCTTGCTTCCGCGTCGCAGCTCGTCCGCTAATCACGAACTCAAAGCTC
CTGGCCTTCAACATCGGTTACCACTATCAAGACATTCAAAAGGCCGTCTACATTGGACTAGGAGGAACGCTGCTG
ACATTTCTTGTCGTGGTGCCGCCGTGGCCGTTCTACAACAAGAACCCCGTCAAATGGCTACCTGCCGGCTCCGGA
CTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail