Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06039
Gene name
Locationscaffold_07:470981..471374
Strand+
Gene length (bp)393
Transcript length (bp)393
Coding sequence length (bp)393
Protein length (aa) 131

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09435 DUF2015 Fungal protein of unknown function (DUF2015) 3.7E-45 12 125

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 5 24 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 204.15 108.47 299.82
Alive In ants, during behavior modification 255.84 140.39 371.28
Dead In ants, recently dead 311.28 174.16 448.40

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.291814 no
Alive Dead 0.257582 no
Dead Fungus 0.028747 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06039
MAYKYILFSFSVFLFIVATALFVTRDHWRRHVPAIRLPGAGYIYSQLPRSFVDDIEAGLSSDTFDLGGNVEAGDG
RAGLDSAGKAEILKIMKKRRMTFDQARKTYMENRFKANGIGADGRPRDPKFVSFS*
Coding >Ophcf2|06039
ATGGCCTACAAATACATCCTCTTCAGCTTCTCCGTCTTCCTCTTCATCGTCGCCACCGCCCTCTTCGTCACCCGC
GATCACTGGCGTCGTCACGTTCCCGCCATTCGTCTTCCCGGCGCCGGCTACATCTACTCTCAGTTGCCCCGGAGC
TTCGTCGACGATATCGAGGCCGGGCTGTCGAGCGATACCTTTGACCTGGGCGGCAATGTCGAGGCTGGCGACGGT
CGCGCAGGCCTAGACAGCGCGGGAAAGGCCGAGATTCTCAAGATCATGAAGAAGAGGCGCATGACGTTTGACCAG
GCTCGCAAGACGTATATGGAGAACCGGTTCAAGGCCAACGGTATCGGCGCCGACGGCCGTCCGCGGGATCCCAAG
TTTGTCAGCTTTTCCTGA
Transcript >Ophcf2|06039
ATGGCCTACAAATACATCCTCTTCAGCTTCTCCGTCTTCCTCTTCATCGTCGCCACCGCCCTCTTCGTCACCCGC
GATCACTGGCGTCGTCACGTTCCCGCCATTCGTCTTCCCGGCGCCGGCTACATCTACTCTCAGTTGCCCCGGAGC
TTCGTCGACGATATCGAGGCCGGGCTGTCGAGCGATACCTTTGACCTGGGCGGCAATGTCGAGGCTGGCGACGGT
CGCGCAGGCCTAGACAGCGCGGGAAAGGCCGAGATTCTCAAGATCATGAAGAAGAGGCGCATGACGTTTGACCAG
GCTCGCAAGACGTATATGGAGAACCGGTTCAAGGCCAACGGTATCGGCGCCGACGGCCGTCCGCGGGATCCCAAG
TTTGTCAGCTTTTCCTGA
Gene >Ophcf2|06039
ATGGCCTACAAATACATCCTCTTCAGCTTCTCCGTCTTCCTCTTCATCGTCGCCACCGCCCTCTTCGTCACCCGC
GATCACTGGCGTCGTCACGTTCCCGCCATTCGTCTTCCCGGCGCCGGCTACATCTACTCTCAGTTGCCCCGGAGC
TTCGTCGACGATATCGAGGCCGGGCTGTCGAGCGATACCTTTGACCTGGGCGGCAATGTCGAGGCTGGCGACGGT
CGCGCAGGCCTAGACAGCGCGGGAAAGGCCGAGATTCTCAAGATCATGAAGAAGAGGCGCATGACGTTTGACCAG
GCTCGCAAGACGTATATGGAGAACCGGTTCAAGGCCAACGGTATCGGCGCCGACGGCCGTCCGCGGGATCCCAAG
TTTGTCAGCTTTTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail