Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06039
Gene name
Locationscaffold_07:470981..471374
Strand+
Gene length (bp)393
Transcript length (bp)393
Coding sequence length (bp)393
Protein length (aa) 131

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09435 DUF2015 Fungal protein of unknown function (DUF2015) 3.7E-45 12 125

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 5 24 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06039
MAYKYILFSFSVFLFIVATALFVTRDHWRRHVPAIRLPGAGYIYSQLPRSFVDDIEAGLSSDTFDLGGNVEAGDG
RAGLDSAGKAEILKIMKKRRMTFDQARKTYMENRFKANGIGADGRPRDPKFVSFS*
Coding >Ophcf2|06039
ATGGCCTACAAATACATCCTCTTCAGCTTCTCCGTCTTCCTCTTCATCGTCGCCACCGCCCTCTTCGTCACCCGC
GATCACTGGCGTCGTCACGTTCCCGCCATTCGTCTTCCCGGCGCCGGCTACATCTACTCTCAGTTGCCCCGGAGC
TTCGTCGACGATATCGAGGCCGGGCTGTCGAGCGATACCTTTGACCTGGGCGGCAATGTCGAGGCTGGCGACGGT
CGCGCAGGCCTAGACAGCGCGGGAAAGGCCGAGATTCTCAAGATCATGAAGAAGAGGCGCATGACGTTTGACCAG
GCTCGCAAGACGTATATGGAGAACCGGTTCAAGGCCAACGGTATCGGCGCCGACGGCCGTCCGCGGGATCCCAAG
TTTGTCAGCTTTTCCTGA
Transcript >Ophcf2|06039
ATGGCCTACAAATACATCCTCTTCAGCTTCTCCGTCTTCCTCTTCATCGTCGCCACCGCCCTCTTCGTCACCCGC
GATCACTGGCGTCGTCACGTTCCCGCCATTCGTCTTCCCGGCGCCGGCTACATCTACTCTCAGTTGCCCCGGAGC
TTCGTCGACGATATCGAGGCCGGGCTGTCGAGCGATACCTTTGACCTGGGCGGCAATGTCGAGGCTGGCGACGGT
CGCGCAGGCCTAGACAGCGCGGGAAAGGCCGAGATTCTCAAGATCATGAAGAAGAGGCGCATGACGTTTGACCAG
GCTCGCAAGACGTATATGGAGAACCGGTTCAAGGCCAACGGTATCGGCGCCGACGGCCGTCCGCGGGATCCCAAG
TTTGTCAGCTTTTCCTGA
Gene >Ophcf2|06039
ATGGCCTACAAATACATCCTCTTCAGCTTCTCCGTCTTCCTCTTCATCGTCGCCACCGCCCTCTTCGTCACCCGC
GATCACTGGCGTCGTCACGTTCCCGCCATTCGTCTTCCCGGCGCCGGCTACATCTACTCTCAGTTGCCCCGGAGC
TTCGTCGACGATATCGAGGCCGGGCTGTCGAGCGATACCTTTGACCTGGGCGGCAATGTCGAGGCTGGCGACGGT
CGCGCAGGCCTAGACAGCGCGGGAAAGGCCGAGATTCTCAAGATCATGAAGAAGAGGCGCATGACGTTTGACCAG
GCTCGCAAGACGTATATGGAGAACCGGTTCAAGGCCAACGGTATCGGCGCCGACGGCCGTCCGCGGGATCCCAAG
TTTGTCAGCTTTTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail