Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06035
Gene name
Locationscaffold_07:463316..466210
Strand+
Gene length (bp)2894
Transcript length (bp)2574
Coding sequence length (bp)2574
Protein length (aa) 858

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19316 PIGO_PIGG GPI ethanolamine phosphate transferase membrane region 1.5E-157 438 856
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 9.1E-10 196 271

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 446 465 19
3 472 494 22
4 567 584 17
5 644 663 19
6 752 774 22
7 795 817 22
8 832 854 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06035
MKAISTKASLSCALLAAANLVLPIAILVFATGFFPRKPILPGLASFESLPEFGSPPSAPFDRLIFMVVDALRSDF
VYSNQSGFQYTQSLIRNGAAIPFTANARTPTVTMPRIKAMTTGSIPSFVDLILNIDEADTSSSLAHQDSWLAQLK
AADKGKLLMYGDDTWLKLFPNIFDRHDGTSSFFVSDFTEVDHNVTRNVPAELERSDWALMVLHYLGLDHIGHKAG
PRSSNMVPKQREMDDVVETIFKAIESNDHLKSTLLVLCGDHGMNDAGNHGASSPGETSAALLFLSPKLRAISRGL
PAPTQPRAEFDYYASVEQSDIAPTLAALLGLPVSKNNLGAFIPDFLPFWSKDSDRLQILLRNAKQMLGIVKSAFG
DRLFDTQGAPDPCRMAATNVNELACEWRRISRESASAGNVDPVWLSDAAAWLRKAQDLMSSMASNFSTEKLVYGQ
VMGTIAVGLAVLATLTQQTLTGSSYWPILVISLLYGIMNFASSYVEEEQHFWYWSCSLWMAWLGSRSLRRSGRLW
PAGYHLLALVCLRLARSWNQTGQKFAGEPDIVKLFLAPNPQFTWALVSLAYAIVAFRIVKSLPGLPSVLRLSSTS
ALISAAFSFKLAFTAQDAPELVTGLAGRVNEALQGPSLTVRARSVFVLLALGAVLAVIRGGMGRHLVQPSARLLH
HLYTLFAMTQSRTTNIPLIVLAQTMCHCLEMDDLSLSEVTTSCLLLQYAFFFAFGGSNAISSVDLSSSYNGFDNF
NAVAVGSLTFVSNWAGPIFWTSAANLVLLQKHVGSRADVCRRHLMLLTLFVNASALSVMVACNALRTHLFIWTVF
SPRYLYVMAWSIAYHLVTNAGLGSLLFLLGAR*
Coding >Ophcf2|06035
ATGAAGGCCATCTCAACAAAGGCGTCCCTGTCCTGCGCCCTGCTGGCTGCCGCGAATCTCGTCTTGCCGATAGCC
ATCCTCGTCTTCGCCACCGGCTTCTTCCCCCGCAAGCCGATCCTCCCCGGCCTGGCCAGTTTCGAATCCCTTCCC
GAGTTTGGTTCTCCTCCGAGCGCCCCATTCGACCGGCTTATCTTCATGGTTGTTGATGCTTTGAGAAGTGATTTC
GTCTACTCGAACCAATCCGGCTTTCAATACACACAGAGTCTCATTCGCAATGGCGCCGCAATCCCCTTTACCGCC
AATGCTCGTACTCCTACGGTGACGATGCCCCGGATCAAGGCCATGACTACCGGCTCGATTCCTTCATTCGTCGAC
CTCATCCTAAACATCGACGAGGCCGACACTTCGTCTTCCCTGGCCCATCAGGACTCCTGGTTGGCGCAGCTCAAA
GCTGCAGACAAGGGCAAGCTTCTCATGTACGGAGACGACACCTGGCTCAAGCTATTTCCGAACATCTTTGACCGT
CACGATGGCACCTCGAGCTTCTTCGTTTCCGACTTTACCGAGGTTGATCACAACGTAACGAGAAATGTACCTGCC
GAGCTGGAGCGGTCAGACTGGGCTCTGATGGTGCTGCATTACCTCGGTCTCGATCACATCGGCCACAAGGCCGGT
CCCAGAAGCTCCAATATGGTGCCCAAGCAGCGGGAGATGGATGACGTCGTCGAGACCATCTTCAAGGCCATCGAG
TCCAACGACCATCTTAAATCGACTCTGCTTGTCTTGTGCGGCGATCACGGCATGAACGATGCCGGAAACCACGGA
GCCTCATCCCCTGGCGAGACGTCGGCGGCCCTTCTCTTTCTGTCTCCCAAGCTGAGGGCCATATCTCGAGGCTTG
CCCGCTCCAACGCAGCCTCGGGCCGAGTTCGACTACTACGCGTCTGTTGAGCAGTCTGACATCGCCCCGACTCTT
GCCGCGCTGCTCGGGCTCCCCGTGTCCAAGAATAATCTAGGCGCATTCATACCCGACTTTCTGCCCTTTTGGTCC
AAAGACAGCGATAGACTTCAGATCCTTCTCCGCAACGCCAAGCAGATGCTCGGCATCGTCAAGTCCGCATTTGGA
GACCGTCTTTTCGACACCCAGGGCGCTCCCGACCCGTGCCGGATGGCTGCTACCAACGTTAACGAGCTTGCCTGC
GAGTGGCGTCGCATCAGCCGGGAGTCAGCATCCGCGGGCAATGTCGATCCGGTCTGGCTCTCGGATGCAGCGGCA
TGGCTGCGCAAAGCTCAGGATCTGATGAGCAGCATGGCCTCCAATTTCAGCACGGAGAAACTGGTCTACGGTCAG
GTAATGGGCACTATAGCCGTTGGATTGGCTGTTCTCGCAACCTTGACGCAACAGACGCTCACCGGCAGCAGCTAT
TGGCCTATTTTGGTCATCTCGCTGTTGTATGGTATCATGAACTTTGCCAGCAGCTACGTGGAGGAGGAACAGCAC
TTCTGGTACTGGTCTTGCTCGCTGTGGATGGCCTGGCTCGGCTCGCGCTCCCTCCGCAGATCCGGGAGACTATGG
CCCGCCGGCTACCATCTGCTGGCCCTTGTTTGCCTGCGGCTGGCGAGAAGCTGGAACCAGACTGGCCAAAAGTTC
GCCGGCGAGCCCGATATCGTCAAGCTGTTCCTCGCCCCGAACCCGCAGTTCACTTGGGCACTCGTCAGCCTAGCT
TATGCCATCGTCGCCTTTCGAATTGTAAAAAGCCTGCCTGGTCTTCCGTCCGTCCTCAGATTGTCCTCAACATCT
GCCCTCATCTCCGCCGCCTTCAGCTTCAAGCTGGCTTTTACAGCTCAGGACGCCCCTGAGTTGGTGACAGGCCTC
GCCGGAAGGGTCAACGAGGCATTACAAGGCCCCTCGCTGACAGTACGGGCGCGGTCTGTCTTTGTGCTTCTTGCG
CTGGGAGCTGTCTTAGCCGTGATTAGAGGGGGCATGGGGCGTCACTTGGTGCAACCATCTGCCCGTCTTCTCCAT
CACCTGTACACCCTTTTCGCCATGACGCAGTCTCGCACAACCAACATTCCCCTTATCGTGCTGGCCCAGACCATG
TGCCATTGTCTCGAGATGGACGACCTGTCTCTGAGCGAAGTGACGACGTCTTGTCTCTTGCTGCAATACGCCTTC
TTCTTTGCCTTTGGTGGCTCCAACGCCATCTCGTCGGTCGACTTGTCCAGCTCGTACAACGGCTTCGACAACTTC
AATGCAGTTGCCGTGGGCAGCCTCACCTTCGTCAGCAACTGGGCCGGTCCCATCTTTTGGACGTCGGCCGCCAAT
TTGGTGCTTCTGCAGAAACACGTGGGAAGTCGAGCCGATGTCTGCCGACGCCATCTGATGCTTCTCACTCTGTTC
GTCAACGCTAGCGCGCTTTCCGTCATGGTGGCCTGCAATGCGCTGAGGACTCATCTGTTCATCTGGACCGTCTTC
TCGCCGAGGTATCTGTACGTGATGGCATGGTCGATTGCGTATCATCTTGTCACGAATGCCGGACTCGGATCTCTT
CTTTTTCTACTGGGTGCAAGGTGA
Transcript >Ophcf2|06035
ATGAAGGCCATCTCAACAAAGGCGTCCCTGTCCTGCGCCCTGCTGGCTGCCGCGAATCTCGTCTTGCCGATAGCC
ATCCTCGTCTTCGCCACCGGCTTCTTCCCCCGCAAGCCGATCCTCCCCGGCCTGGCCAGTTTCGAATCCCTTCCC
GAGTTTGGTTCTCCTCCGAGCGCCCCATTCGACCGGCTTATCTTCATGGTTGTTGATGCTTTGAGAAGTGATTTC
GTCTACTCGAACCAATCCGGCTTTCAATACACACAGAGTCTCATTCGCAATGGCGCCGCAATCCCCTTTACCGCC
AATGCTCGTACTCCTACGGTGACGATGCCCCGGATCAAGGCCATGACTACCGGCTCGATTCCTTCATTCGTCGAC
CTCATCCTAAACATCGACGAGGCCGACACTTCGTCTTCCCTGGCCCATCAGGACTCCTGGTTGGCGCAGCTCAAA
GCTGCAGACAAGGGCAAGCTTCTCATGTACGGAGACGACACCTGGCTCAAGCTATTTCCGAACATCTTTGACCGT
CACGATGGCACCTCGAGCTTCTTCGTTTCCGACTTTACCGAGGTTGATCACAACGTAACGAGAAATGTACCTGCC
GAGCTGGAGCGGTCAGACTGGGCTCTGATGGTGCTGCATTACCTCGGTCTCGATCACATCGGCCACAAGGCCGGT
CCCAGAAGCTCCAATATGGTGCCCAAGCAGCGGGAGATGGATGACGTCGTCGAGACCATCTTCAAGGCCATCGAG
TCCAACGACCATCTTAAATCGACTCTGCTTGTCTTGTGCGGCGATCACGGCATGAACGATGCCGGAAACCACGGA
GCCTCATCCCCTGGCGAGACGTCGGCGGCCCTTCTCTTTCTGTCTCCCAAGCTGAGGGCCATATCTCGAGGCTTG
CCCGCTCCAACGCAGCCTCGGGCCGAGTTCGACTACTACGCGTCTGTTGAGCAGTCTGACATCGCCCCGACTCTT
GCCGCGCTGCTCGGGCTCCCCGTGTCCAAGAATAATCTAGGCGCATTCATACCCGACTTTCTGCCCTTTTGGTCC
AAAGACAGCGATAGACTTCAGATCCTTCTCCGCAACGCCAAGCAGATGCTCGGCATCGTCAAGTCCGCATTTGGA
GACCGTCTTTTCGACACCCAGGGCGCTCCCGACCCGTGCCGGATGGCTGCTACCAACGTTAACGAGCTTGCCTGC
GAGTGGCGTCGCATCAGCCGGGAGTCAGCATCCGCGGGCAATGTCGATCCGGTCTGGCTCTCGGATGCAGCGGCA
TGGCTGCGCAAAGCTCAGGATCTGATGAGCAGCATGGCCTCCAATTTCAGCACGGAGAAACTGGTCTACGGTCAG
GTAATGGGCACTATAGCCGTTGGATTGGCTGTTCTCGCAACCTTGACGCAACAGACGCTCACCGGCAGCAGCTAT
TGGCCTATTTTGGTCATCTCGCTGTTGTATGGTATCATGAACTTTGCCAGCAGCTACGTGGAGGAGGAACAGCAC
TTCTGGTACTGGTCTTGCTCGCTGTGGATGGCCTGGCTCGGCTCGCGCTCCCTCCGCAGATCCGGGAGACTATGG
CCCGCCGGCTACCATCTGCTGGCCCTTGTTTGCCTGCGGCTGGCGAGAAGCTGGAACCAGACTGGCCAAAAGTTC
GCCGGCGAGCCCGATATCGTCAAGCTGTTCCTCGCCCCGAACCCGCAGTTCACTTGGGCACTCGTCAGCCTAGCT
TATGCCATCGTCGCCTTTCGAATTGTAAAAAGCCTGCCTGGTCTTCCGTCCGTCCTCAGATTGTCCTCAACATCT
GCCCTCATCTCCGCCGCCTTCAGCTTCAAGCTGGCTTTTACAGCTCAGGACGCCCCTGAGTTGGTGACAGGCCTC
GCCGGAAGGGTCAACGAGGCATTACAAGGCCCCTCGCTGACAGTACGGGCGCGGTCTGTCTTTGTGCTTCTTGCG
CTGGGAGCTGTCTTAGCCGTGATTAGAGGGGGCATGGGGCGTCACTTGGTGCAACCATCTGCCCGTCTTCTCCAT
CACCTGTACACCCTTTTCGCCATGACGCAGTCTCGCACAACCAACATTCCCCTTATCGTGCTGGCCCAGACCATG
TGCCATTGTCTCGAGATGGACGACCTGTCTCTGAGCGAAGTGACGACGTCTTGTCTCTTGCTGCAATACGCCTTC
TTCTTTGCCTTTGGTGGCTCCAACGCCATCTCGTCGGTCGACTTGTCCAGCTCGTACAACGGCTTCGACAACTTC
AATGCAGTTGCCGTGGGCAGCCTCACCTTCGTCAGCAACTGGGCCGGTCCCATCTTTTGGACGTCGGCCGCCAAT
TTGGTGCTTCTGCAGAAACACGTGGGAAGTCGAGCCGATGTCTGCCGACGCCATCTGATGCTTCTCACTCTGTTC
GTCAACGCTAGCGCGCTTTCCGTCATGGTGGCCTGCAATGCGCTGAGGACTCATCTGTTCATCTGGACCGTCTTC
TCGCCGAGGTATCTGTACGTGATGGCATGGTCGATTGCGTATCATCTTGTCACGAATGCCGGACTCGGATCTCTT
CTTTTTCTACTGGGTGCAAGGTGA
Gene >Ophcf2|06035
ATGAAGGCCATCTCAACAAAGGCGTCCCTGTCCTGCGCCCTGCTGGCTGCCGCGAATCTCGTCTTGCCGATAGCC
ATCCTCGTCTTCGCCACCGGCTTCTTCCCCCGCAAGCCGATCCTCCCCGGCCTGGCCAGTTTCGAATCCCTTCCC
GAGTTTGGTTCTCCTCCGAGCGCCCCATTCGACCGGCTTATCTTCATGGTTGTTGATGCTTTGAGAAGGCAGGTC
AATGTTCGTATAACGACATCCTCCGCAGTCCAGCTGACAACTCGACAGTGATTTCGTCTACTCGAACCAATCCGG
CTTTCAATACACACAGAGGTTCATTTCCCACCAGTCTCATTTGCTGCACCCGCTGACGTGCCTTCTTCATAGTCT
CATTCGCAATGGCGCCGCAATCCCCTTTACCGCCAATGCTCGTACTCCTACGGTGACGATGCCCCGGATCAAGGC
CATGACTACCGGCTCGATTCCTTCATTCGTCGACCTCATCCTAAACATCGACGAGGCCGACACTTCGTCTTCCCT
GGCCCATCAGGACTCCTGGTTGGCGCAGCTCAAAGCTGCAGACAAGGGCAAGCTTCTCATGTACGGAGACGACAC
CTGGCTCAAGCTATTTCCGAACATCTTTGACCGTCACGATGGCACCTCGAGCTTCTTCGTTTCCGTACCGTCCCC
TCTTACCCTCGACTCCTGCCGGCCACTGACTATTGCGACTCTTGGCCCAGGACTTTACCGAGGTTGATCACAACG
TAACGAGAAATGTACCTGCCGAGCTGGAGCGGTCAGACTGGGCTCTGATGGTGCTGCATTACCTCGGTCTCGATC
ACATCGGCCACAAGGCCGGTCCCAGAAGGCATGTGCAGAATTCTAATGCGGATACGGTGCTGACTCGATAACCAG
CTCCAATATGGTGCCCAAGCAGCGGGAGATGGATGACGTCGTCGAGACCATCTTCAAGGCCATCGAGTCCAACGA
CCATCTTAAATCGACTCTGCTTGTCTTGTGCGGCGATCACGGCATGAACGATGCCGGAAACCACGGAGCCTCATC
CCCTGGCGAGACGTCGGCGGCCCTTCTCTTTCTGTCTCCCAAGCTGAGGGCCATATCTCGAGGCTTGCCCGCTCC
AACGCAGCCTCGGGCCGAGTTCGACTACTACGCGTCTGTTGAGCAGTCTGACATCGCCCCGACTCTTGCCGCGCT
GCTCGGGCTCCCCGTGTCCAAGAATAATCTAGGCGCATTCATACCCGACTTTCTGCCCTTTTGGTCCAAAGACAG
CGATAGACTTCAGATCCTTCTCCGCAACGCCAAGCAGATGCTCGGCATCGTCAAGTCCGCATTTGGAGACCGTCT
TTTCGACACCCAGGGCGCTCCCGACCCGTGCCGGATGGCTGCTACCAACGTTAACGAGCTTGCCTGCGAGTGGCG
TCGCATCAGCCGGGAGTCAGCATCCGCGGGCAATGTCGATCCGGTCTGGCTCTCGGATGCAGCGGCATGGCTGCG
CAAAGCTCAGGATCTGATGAGCAGCATGGCCTCCAATTTCAGCACGGAGAAACTGGTCTACGGTCAGGTAATGGG
CACTATAGCCGTTGGATTGGCTGTTCTCGCAACCTTGACGCAACAGACGCTCACCGGCAGCAGCTATTGGCCTAT
TTTGGTCATCTCGCTGTTGTATGGTATCATGAACTTTGCCAGCAGCTACGTGGAGGAGGAACAGCACTTCTGGTA
CTGGTCTTGCTCGCTGTGGATGGCCTGGCTCGGCTCGCGCTCCCTCCGCAGGTAAGACGACGTCTACTGTGCTCT
TGCACCGAGAGGCTCACTGGCGTATAGATCCGGGAGACTATGGCCCGCCGGCTACCATCTGCTGGCCCTTGTTTG
CCTGCGGCTGGCGAGAAGCTGGAACCAGACTGGCCAAAAGTTCGCCGGCGAGCCCGATATCGTCAAGCTGTTCCT
CGCCCCGAACCCGCAGTTCACTTGGGCACTCGTCAGCCTAGCTTATGCCATCGTCGCCTTTCGAATTGTAAAAAG
CCTGCCTGGTCTTCCGTCCGTCCTCAGATTGTCCTCAACATCTGCCCTCATCTCCGCCGCCTTCAGCTTCAAGCT
GGCTTTTACAGCTCAGGACGCCCCTGAGTTGGTGACAGGCCTCGCCGGAAGGGTCAACGAGGCATTACAAGGCCC
CTCGCTGACAGTACGGGCGCGGTCTGTCTTTGTGCTTCTTGCGCTGGGAGCTGTCTTAGCCGTGATTAGAGGGGG
CATGGGGCGTCACTTGGTGCAACCATCTGGTGCGTATAGGCGTCGACGGTCTGTTGTGGCATCGCTAACAGGATT
GCCCAGCCCGTCTTCTCCATCACCTGTACACCCTTTTCGCCATGACGCAGTCTCGCACAACCAACATTCCCCTTA
TCGTGCTGGCCCAGACCATGTGCCATTGTCTCGAGATGGACGACCTGTCTCTGAGCGAAGTGACGACGTCTTGTC
TCTTGCTGCAATACGCCTTCTTCTTTGCCTTTGGTGGCTCCAACGCCATCTCGTCGGTCGACTTGTCCAGCTCGT
ACAACGGCTTCGACAACTTCAATGCAGTTGCCGTGGGCAGCCTCACCTTCGTCAGCAACTGGGCCGGTCCCATCT
TTTGGACGTCGGCCGCCAATTTGGTGCTTCTGCAGAAACACGTGGGAAGTCGAGCCGATGTCTGCCGACGCCATC
TGATGCTTCTCACTCTGTTCGTCAACGCTAGCGCGCTTTCCGTCATGGTGGCCTGCAATGCGCTGAGGACTCATC
TGTTCATCTGGACCGTCTTCTCGCCGAGGTATCTGTACGTGATGGCATGGTCGATTGCGTATCATCTTGTCACGA
ATGCCGGACTCGGATCTCTTCTTTTTCTACTGGGTGCAAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail