Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06032
Gene name
Locationscaffold_07:455910..459221
Strand+
Gene length (bp)3311
Transcript length (bp)3258
Coding sequence length (bp)3258
Protein length (aa) 1086

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12719 Cnd3 Nuclear condensing complex subunits, C-term domain 6.3E-91 649 940

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3957 0.8535 0.1987 0.0458 0.1317 0.0234 0.0596 0.0269 0.1927 0.0029

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3566
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|282
Ophiocordyceps australis map64 (Brazil) OphauB2|7145
Ophiocordyceps camponoti-floridani Ophcf2|06032 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3130
Ophiocordyceps kimflemingae Ophio5|7177
Ophiocordyceps subramaniannii Hirsu2|6846

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06032
MPAKSSSRSTRTSSAMPKKPSTTGPGSKATRATRASASPSPAVEYHETPSNNPLRTRICAVFRDAQRTTATHRKL
AITLRKVHEACCHEASNDDDADETAFKREFVRCVLRVMPVKKAESVGERAIRFVGSYLRHAADKDLEALGDVDAE
ASLMPETPSTRLLSDLVEAVFPLMTAKDKYVRYRSTQLVSHIINSLDAIDDDVFQKLRHGLLKRIRDKEAMVRSQ
AVLGLGRLAGNQSEGCTNSDDSDGHDNNEAATDLLGKLLHVMQNDPSADVRRSLLINLPILPNTLPHLLERARDQ
DPATRRAVYSRLLPALGDFRHLSLSMREKLLRWGLRDRDEKVRKAAGRLFRERWIADCAGIAQQEDGPVLETTPN
LDGLLELLERIDVVNSGVENGIALEAMKGFWQGRPDYREAIVLDDAFWETLSAESVFMARSFNDYCRYEDQGRNT
ALVEDKMPEVTKLAFYLERYMHALLEALKKQDEDADGEEEDEDDEDTVEQEFIVEQLLHISLTLDYSDEVGRRKM
FTLVRQALSKPELPDEITKLTVQVLHYICAPDAAGEREFCSVVLESVADVHDTIGGDDDDVNDADERPTADDDDE
NDSFHSAQSEVKSGEKKAKNKDRRSRSDSQSSEDAAREKAVREIVINMKCLHIVQCMLTHVSGNLKDNADLVSML
NNLVVPAVRSHEAPVRERGLVCLGLCALLDRSLADENLGLFIHFYSKGHAALQMTALHVLTDMLNVHGPQLLAAT
PALLKVYVKAVKAAKAPEVQAVAALAASKLLLGRVVADQDACEELLKALVIAYFDPASASNQPVRQALNYFLPVF
CYSRPANQQLMRTIALQALHSLLTLRQALQDDDVDVDEDMVSMTTIGACLVDWTDPRKCYSPSSSAIQPDADKKQ
PAVNGDVHLDFARDILERLRTNISKEEKKLIASLLGKLHVSPGSTEDTIRDLYAQISDAVTEGLLSDATSRNALY
KLHVSLGKIVNSLDEQQQQQQQQPYNRRSSRSASVALDRQPVEDKTIVEEPDIKEEDEDEGEAGGGGGGGGGYDD
DEDDGQDDKTVIHKVEARDEVVDSFLSDEEDVGIM*
Coding >Ophcf2|06032
ATGCCGGCGAAATCATCCTCGCGATCGACGCGAACATCCTCAGCCATGCCCAAGAAGCCATCGACGACAGGCCCA
GGTTCCAAAGCGACACGCGCGACACGCGCTTCAGCCTCACCATCACCAGCCGTCGAATACCACGAAACCCCGAGC
AACAACCCGCTACGAACACGAATCTGCGCCGTCTTCCGCGACGCGCAGCGAACGACGGCGACGCATCGTAAGCTG
GCTATTACCTTGCGAAAGGTGCACGAGGCCTGCTGCCACGAGGCGAGCAACGATGACGACGCGGATGAGACGGCC
TTCAAGCGCGAGTTTGTACGGTGTGTGTTGCGCGTCATGCCTGTTAAAAAGGCCGAGAGCGTCGGAGAGAGGGCT
ATCCGATTCGTTGGGTCTTATCTGAGGCACGCGGCCGACAAGGATTTGGAAGCCCTCGGTGACGTCGACGCCGAG
GCGAGCCTCATGCCCGAGACGCCCAGCACGCGCCTACTCTCAGATCTCGTCGAGGCCGTCTTCCCGCTCATGACA
GCCAAGGACAAGTACGTACGCTACCGGTCAACGCAGCTCGTGTCACACATCATCAACTCGCTCGACGCCATCGAC
GACGATGTCTTCCAGAAGCTGCGCCACGGACTCCTCAAGCGTATCCGTGACAAGGAAGCCATGGTCCGCTCTCAG
GCCGTCCTTGGGCTGGGTCGTCTAGCAGGAAATCAGTCAGAAGGCTGCACCAACTCGGACGATAGCGACGGCCAT
GACAACAACGAAGCCGCCACCGACCTGCTAGGAAAGCTTCTACACGTGATGCAGAACGACCCCAGCGCCGACGTC
CGCCGCTCGCTGCTCATAAACCTCCCAATCCTGCCCAACACGCTCCCCCATCTTCTGGAGCGAGCTCGCGATCAG
GACCCGGCGACGAGGAGGGCCGTGTATTCGCGTCTACTACCGGCGCTCGGCGACTTCCGCCACCTATCTCTATCG
ATGCGCGAGAAGCTGCTCCGCTGGGGTCTCCGAGACCGTGATGAAAAAGTCCGCAAGGCAGCCGGGAGACTCTTC
CGCGAGCGGTGGATCGCCGACTGCGCGGGCATAGCCCAGCAGGAAGACGGCCCGGTGCTGGAAACGACGCCCAAC
TTGGACGGACTGCTGGAACTCTTAGAGAGGATCGACGTGGTCAACTCGGGCGTCGAAAACGGCATCGCTCTCGAG
GCCATGAAGGGCTTCTGGCAAGGTCGTCCGGACTACCGCGAGGCTATCGTGCTGGACGACGCCTTCTGGGAGACG
CTATCAGCCGAGTCCGTCTTCATGGCCCGCAGCTTCAACGACTACTGTCGATATGAGGACCAAGGCAGAAACACG
GCTCTCGTCGAAGATAAGATGCCCGAGGTGACGAAGCTGGCGTTTTACCTAGAACGCTACATGCACGCCCTCCTC
GAAGCCCTCAAGAAGCAAGACGAAGACGCCGACGGAGAGGAGGAAGACGAAGACGACGAAGACACGGTCGAGCAA
GAGTTCATCGTAGAACAGCTGCTACACATATCCCTAACCCTCGACTACTCAGACGAAGTCGGCCGCCGCAAAATG
TTCACCCTCGTCCGCCAAGCGCTCTCCAAGCCCGAGCTCCCAGACGAGATAACCAAGCTGACGGTCCAAGTGCTG
CATTACATCTGCGCGCCCGACGCCGCAGGAGAGCGCGAGTTTTGCAGCGTCGTTCTCGAATCCGTCGCCGACGTT
CACGATACCATCGGCGGTGACGACGATGACGTCAACGACGCTGACGAGCGGCCCACGGCCGACGATGATGATGAG
AACGACAGCTTCCATTCTGCTCAATCCGAGGTGAAATCAGGCGAGAAGAAGGCCAAAAACAAGGATCGACGCTCT
CGATCAGACTCCCAGTCGTCGGAAGACGCAGCCCGCGAAAAGGCCGTCCGCGAAATCGTCATCAACATGAAATGC
CTTCACATCGTCCAATGCATGCTCACGCACGTCTCTGGCAACCTCAAAGACAACGCCGACCTGGTCTCCATGCTA
AATAACCTCGTTGTTCCCGCCGTTCGCAGCCACGAAGCTCCCGTTCGCGAACGAGGTCTCGTCTGTCTCGGGCTC
TGCGCGCTGCTGGATCGCTCGCTGGCTGACGAGAACCTCGGTCTCTTCATTCACTTCTACTCCAAGGGTCACGCA
GCGCTGCAGATGACGGCGTTGCATGTTCTTACCGATATGCTCAACGTTCACGGGCCTCAGCTGCTGGCCGCCACG
CCCGCCCTGCTCAAGGTCTACGTCAAGGCCGTCAAGGCCGCAAAGGCGCCCGAAGTGCAGGCCGTTGCTGCTCTG
GCGGCCTCGAAGCTGCTGCTCGGTCGCGTCGTCGCCGATCAGGATGCCTGTGAGGAGCTTCTCAAGGCCCTTGTC
ATCGCCTACTTCGACCCGGCATCGGCCTCGAACCAGCCCGTTCGTCAGGCCTTGAATTACTTCCTGCCCGTCTTC
TGCTACTCGCGACCTGCCAATCAGCAGCTCATGCGCACCATTGCTCTTCAAGCTCTGCACTCGTTGTTGACGCTG
CGTCAGGCGTTGCAAGACGACGATGTCGATGTCGACGAGGACATGGTTAGCATGACCACTATTGGCGCCTGTCTC
GTCGACTGGACCGATCCGCGGAAGTGTTATTCTCCTTCTTCGTCTGCTATCCAGCCGGACGCGGACAAGAAGCAG
CCCGCCGTCAACGGCGACGTCCACCTCGACTTTGCCCGCGATATTCTCGAGAGGCTACGCACTAACATCAGCAAG
GAGGAAAAGAAACTCATCGCCAGTCTCTTGGGCAAGCTCCACGTCTCCCCCGGTTCAACCGAAGACACCATTCGC
GACCTCTACGCCCAGATCAGCGACGCCGTCACCGAGGGTCTGCTCTCTGACGCCACCAGCCGCAACGCTCTGTAC
AAGCTGCACGTCAGCCTGGGTAAAATTGTCAACAGCCTGGACGAGCAGCAGCAGCAGCAGCAGCAGCAGCCCTAC
AACAGGCGCTCCAGCCGCAGCGCATCCGTGGCCCTGGACAGACAGCCTGTCGAGGACAAGACTATCGTCGAGGAG
CCGGACATCAAAGAGGAGGACGAAGACGAGGGCGAGGCTGGTGGCGGTGGCGGTGGCGGTGGCGGCTATGACGAC
GACGAGGACGACGGCCAAGACGACAAGACTGTCATTCACAAGGTCGAGGCAAGAGATGAAGTCGTCGATAGCTTT
TTATCGGATGAAGAGGACGTCGGGATTATGTAA
Transcript >Ophcf2|06032
ATGCCGGCGAAATCATCCTCGCGATCGACGCGAACATCCTCAGCCATGCCCAAGAAGCCATCGACGACAGGCCCA
GGTTCCAAAGCGACACGCGCGACACGCGCTTCAGCCTCACCATCACCAGCCGTCGAATACCACGAAACCCCGAGC
AACAACCCGCTACGAACACGAATCTGCGCCGTCTTCCGCGACGCGCAGCGAACGACGGCGACGCATCGTAAGCTG
GCTATTACCTTGCGAAAGGTGCACGAGGCCTGCTGCCACGAGGCGAGCAACGATGACGACGCGGATGAGACGGCC
TTCAAGCGCGAGTTTGTACGGTGTGTGTTGCGCGTCATGCCTGTTAAAAAGGCCGAGAGCGTCGGAGAGAGGGCT
ATCCGATTCGTTGGGTCTTATCTGAGGCACGCGGCCGACAAGGATTTGGAAGCCCTCGGTGACGTCGACGCCGAG
GCGAGCCTCATGCCCGAGACGCCCAGCACGCGCCTACTCTCAGATCTCGTCGAGGCCGTCTTCCCGCTCATGACA
GCCAAGGACAAGTACGTACGCTACCGGTCAACGCAGCTCGTGTCACACATCATCAACTCGCTCGACGCCATCGAC
GACGATGTCTTCCAGAAGCTGCGCCACGGACTCCTCAAGCGTATCCGTGACAAGGAAGCCATGGTCCGCTCTCAG
GCCGTCCTTGGGCTGGGTCGTCTAGCAGGAAATCAGTCAGAAGGCTGCACCAACTCGGACGATAGCGACGGCCAT
GACAACAACGAAGCCGCCACCGACCTGCTAGGAAAGCTTCTACACGTGATGCAGAACGACCCCAGCGCCGACGTC
CGCCGCTCGCTGCTCATAAACCTCCCAATCCTGCCCAACACGCTCCCCCATCTTCTGGAGCGAGCTCGCGATCAG
GACCCGGCGACGAGGAGGGCCGTGTATTCGCGTCTACTACCGGCGCTCGGCGACTTCCGCCACCTATCTCTATCG
ATGCGCGAGAAGCTGCTCCGCTGGGGTCTCCGAGACCGTGATGAAAAAGTCCGCAAGGCAGCCGGGAGACTCTTC
CGCGAGCGGTGGATCGCCGACTGCGCGGGCATAGCCCAGCAGGAAGACGGCCCGGTGCTGGAAACGACGCCCAAC
TTGGACGGACTGCTGGAACTCTTAGAGAGGATCGACGTGGTCAACTCGGGCGTCGAAAACGGCATCGCTCTCGAG
GCCATGAAGGGCTTCTGGCAAGGTCGTCCGGACTACCGCGAGGCTATCGTGCTGGACGACGCCTTCTGGGAGACG
CTATCAGCCGAGTCCGTCTTCATGGCCCGCAGCTTCAACGACTACTGTCGATATGAGGACCAAGGCAGAAACACG
GCTCTCGTCGAAGATAAGATGCCCGAGGTGACGAAGCTGGCGTTTTACCTAGAACGCTACATGCACGCCCTCCTC
GAAGCCCTCAAGAAGCAAGACGAAGACGCCGACGGAGAGGAGGAAGACGAAGACGACGAAGACACGGTCGAGCAA
GAGTTCATCGTAGAACAGCTGCTACACATATCCCTAACCCTCGACTACTCAGACGAAGTCGGCCGCCGCAAAATG
TTCACCCTCGTCCGCCAAGCGCTCTCCAAGCCCGAGCTCCCAGACGAGATAACCAAGCTGACGGTCCAAGTGCTG
CATTACATCTGCGCGCCCGACGCCGCAGGAGAGCGCGAGTTTTGCAGCGTCGTTCTCGAATCCGTCGCCGACGTT
CACGATACCATCGGCGGTGACGACGATGACGTCAACGACGCTGACGAGCGGCCCACGGCCGACGATGATGATGAG
AACGACAGCTTCCATTCTGCTCAATCCGAGGTGAAATCAGGCGAGAAGAAGGCCAAAAACAAGGATCGACGCTCT
CGATCAGACTCCCAGTCGTCGGAAGACGCAGCCCGCGAAAAGGCCGTCCGCGAAATCGTCATCAACATGAAATGC
CTTCACATCGTCCAATGCATGCTCACGCACGTCTCTGGCAACCTCAAAGACAACGCCGACCTGGTCTCCATGCTA
AATAACCTCGTTGTTCCCGCCGTTCGCAGCCACGAAGCTCCCGTTCGCGAACGAGGTCTCGTCTGTCTCGGGCTC
TGCGCGCTGCTGGATCGCTCGCTGGCTGACGAGAACCTCGGTCTCTTCATTCACTTCTACTCCAAGGGTCACGCA
GCGCTGCAGATGACGGCGTTGCATGTTCTTACCGATATGCTCAACGTTCACGGGCCTCAGCTGCTGGCCGCCACG
CCCGCCCTGCTCAAGGTCTACGTCAAGGCCGTCAAGGCCGCAAAGGCGCCCGAAGTGCAGGCCGTTGCTGCTCTG
GCGGCCTCGAAGCTGCTGCTCGGTCGCGTCGTCGCCGATCAGGATGCCTGTGAGGAGCTTCTCAAGGCCCTTGTC
ATCGCCTACTTCGACCCGGCATCGGCCTCGAACCAGCCCGTTCGTCAGGCCTTGAATTACTTCCTGCCCGTCTTC
TGCTACTCGCGACCTGCCAATCAGCAGCTCATGCGCACCATTGCTCTTCAAGCTCTGCACTCGTTGTTGACGCTG
CGTCAGGCGTTGCAAGACGACGATGTCGATGTCGACGAGGACATGGTTAGCATGACCACTATTGGCGCCTGTCTC
GTCGACTGGACCGATCCGCGGAAGTGTTATTCTCCTTCTTCGTCTGCTATCCAGCCGGACGCGGACAAGAAGCAG
CCCGCCGTCAACGGCGACGTCCACCTCGACTTTGCCCGCGATATTCTCGAGAGGCTACGCACTAACATCAGCAAG
GAGGAAAAGAAACTCATCGCCAGTCTCTTGGGCAAGCTCCACGTCTCCCCCGGTTCAACCGAAGACACCATTCGC
GACCTCTACGCCCAGATCAGCGACGCCGTCACCGAGGGTCTGCTCTCTGACGCCACCAGCCGCAACGCTCTGTAC
AAGCTGCACGTCAGCCTGGGTAAAATTGTCAACAGCCTGGACGAGCAGCAGCAGCAGCAGCAGCAGCAGCCCTAC
AACAGGCGCTCCAGCCGCAGCGCATCCGTGGCCCTGGACAGACAGCCTGTCGAGGACAAGACTATCGTCGAGGAG
CCGGACATCAAAGAGGAGGACGAAGACGAGGGCGAGGCTGGTGGCGGTGGCGGTGGCGGTGGCGGCTATGACGAC
GACGAGGACGACGGCCAAGACGACAAGACTGTCATTCACAAGGTCGAGGCAAGAGATGAAGTCGTCGATAGCTTT
TTATCGGATGAAGAGGACGTCGGGATTATGTAA
Gene >Ophcf2|06032
ATGCCGGCGAAATCATCCTCGCGATCGACGCGAACATCCTCAGCCATGCCCAAGAAGCCATCGACGACAGGCCCA
GGTTCCAAAGCGACACGCGCGACACGCGCTTCAGCCTCACCATCACCAGCCGTCGAATACCACGAAACCCCGAGC
AACAACCCGCTACGAACACGAATCTGCGCCGTCTTCCGCGACGCGCAGCGAACGACGGCGACGCATCGTAAGCTG
GCTATTACCTTGCGAAAGGTGCACGAGGCCTGCTGCCACGAGGCGAGCAACGATGACGACGCGGATGAGACGGCC
TTCAAGCGCGAGTTTGTACGGTGTGTGTTGCGCGTCATGCCTGTTAAAAAGGCCGAGAGCGTCGGAGAGAGGGCT
ATCCGATTCGTTGGGTCTTATCTGAGGCACGCGGCCGACAAGGATTTGGAAGCCCTCGGTGACGTCGACGCCGAG
GCGAGCCTCATGCCCGAGACGCCCAGCACGCGCCTACTCTCAGATCTCGTCGAGGCCGTCTTCCCGCTCATGACA
GCCAAGGACAAGTACGTACGCTACCGGTCAACGCAGCTCGTGTCACACATCATCAACTCGCTCGACGCCATCGAC
GACGATGTCTTCCAGAAGCTGCGCCACGGACTCCTCAAGCGTATCCGTGACAAGGAAGCCATGGTCCGCTCTCAG
GCCGTCCTTGGGCTGGGTCGTCTAGCAGGAAATCAGTCAGAAGGCTGCACCAACTCGGACGATAGCGACGGCCAT
GACAACAACGAAGCCGCCACCGACCTGCTAGGAAAGCTTCTACACGTGATGCAGAACGACCCCAGCGCCGACGTC
CGCCGCTCGCTGCTCATAAACCTCCCAATCCTGCCCAACACGCTCCCCCATCTTCTGGAGCGAGCTCGCGATCAG
GACCCGGCGACGAGGAGGGCCGTGTATTCGCGTCTACTACCGGCGCTCGGCGACTTCCGCCACCTATCTCTATCG
ATGCGCGAGAAGCTGCTCCGCTGGGGTCTCCGAGACCGTGATGAAAAAGTCCGCAAGGCAGCCGGGAGACTCTTC
CGCGAGCGGTGGATCGCCGACTGCGCGGGCATAGCCCAGCAGGAAGACGGCCCGGTGCTGGAAACGACGCCCAAC
TTGGACGGACTGCTGGAACTCTTAGAGAGGATCGACGTGGTCAACTCGGGCGTCGAAAACGGCATCGCTCTCGAG
GCCATGAAGGGCTTCTGGCAAGGTCGTCCGGACTACCGCGAGGCTATCGTGCTGGACGACGCCTTCTGGGAGACG
CTATCAGCCGAGTCCGTCTTCATGGCCCGCAGCTTCAACGACTACTGTCGATATGAGGACCAAGGCAGAAACACG
GCTCTCGTCGAAGATAAGATGCCCGAGGTGACGAAGCTGGCGTTTTACCTAGAACGCTACATGCACGCCCTCCTC
GAAGCCCTCAAGAAGCAAGACGAAGACGCCGACGGAGAGGAGGAAGACGAAGACGACGAAGACACGGTCGAGCAA
GAGTTCATCGTAGAACAGCTGCTACACATATCCCTAACCCTCGACTACTCAGACGAAGTCGGCCGCCGCAAAATG
TTCACCCTCGTCCGCCAAGCGCTCTCCAAGCCCGAGCTCCCAGACGAGATAACCAAGCTGACGGTCCAAGTGCTG
CATTACATCTGCGCGCCCGACGCCGCAGGAGAGCGCGAGTTTTGCAGCGTCGTTCTCGAATCCGTCGCCGACGTT
CACGATACCATCGGCGGTGACGACGATGACGTCAACGACGCTGACGAGCGGCCCACGGCCGACGATGATGATGAG
AACGACAGCTTCCATTCTGCTCAATCCGAGGTGAAATCAGGCGAGAAGAAGGCCAAAAACAAGGATCGACGCTCT
CGATCAGACTCCCAGTCGTCGGAAGACGCAGCCCGCGAAAAGGCCGTCCGCGAAATCGTCATCAACATGAAATGC
CTTCACATCGTCCAATGCATGCTCACGCACGTCTCTGGCAACCTCAAAGACAACGCCGACCTGGTCTCCATGCTA
AATAACCTCGTTGTTCCCGCCGTTCGCAGCCACGAAGCTCCCGTTCGCGAACGAGGTCTCGTCTGTCTCGGGCTC
TGCGCGCTGCTGGATCGCTCGCTGGCTGACGAGAACCTCGGTCTCTTCATTCACTTCTACTCCAAGGGTCACGCA
GCGCTGCAGATGACGGCGTTGCATGTTCTTACCGATATGCTCAACGTTCACGGGCCTCAGCTGCTGGCCGCCACG
CCCGCCCTGCTCAAGGTCTACGTCAAGGCCGTCAAGGCCGCAAAGGCGCCCGAAGTGCAGGCCGTTGCTGCTCTG
GCGGCCTCGAAGCTGCTGCTCGGTCGCGTCGTCGCCGATCAGGATGCCTGTGAGGAGCTTCTCAAGGCCCTTGTC
ATCGCCTACTTCGACCCGGCATCGGCCTCGAACCAGCCCGTTCGTCAGGCCTTGAATTACTTCCTGCCCGTCTTC
TGCTACTCGCGACCTGCCAATCAGCAGCTCATGCGCACCATTGCTCTTCAAGCTCTGCACTCGTTGTTGACGCTG
CGTCAGGCGTTGCAAGACGACGATGTCGATGTCGACGAGGACATGGTTAGCATGACCACTATTGGCGCCTGTCTC
GTCGACTGGACCGATCCGCGGAAGTGTTATTCTCCTTCTTCGTCTGCTATCCAGCCGGACGCGGACAAGAAGCAG
CCCGCCGTCAACGGCGACGTCCACCTCGACTTTGCCCGCGATATTCTCGAGAGGCTACGCACTAACATCAGCAGT
GAGTTCCTGTTCCTCGGTCATCTTTCTTCTCCCTACTGACCCTTCTCTCAGAGGAGGAAAAGAAACTCATCGCCA
GTCTCTTGGGCAAGCTCCACGTCTCCCCCGGTTCAACCGAAGACACCATTCGCGACCTCTACGCCCAGATCAGCG
ACGCCGTCACCGAGGGTCTGCTCTCTGACGCCACCAGCCGCAACGCTCTGTACAAGCTGCACGTCAGCCTGGGTA
AAATTGTCAACAGCCTGGACGAGCAGCAGCAGCAGCAGCAGCAGCAGCCCTACAACAGGCGCTCCAGCCGCAGCG
CATCCGTGGCCCTGGACAGACAGCCTGTCGAGGACAAGACTATCGTCGAGGAGCCGGACATCAAAGAGGAGGACG
AAGACGAGGGCGAGGCTGGTGGCGGTGGCGGTGGCGGTGGCGGCTATGACGACGACGAGGACGACGGCCAAGACG
ACAAGACTGTCATTCACAAGGTCGAGGCAAGAGATGAAGTCGTCGATAGCTTTTTATCGGATGAAGAGGACGTCG
GGATTATGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail