Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06025
Gene name
Locationscaffold_07:436316..438009
Strand-
Gene length (bp)1693
Transcript length (bp)1266
Coding sequence length (bp)1266
Protein length (aa) 422

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05764 YL1 YL1 nuclear protein 5.8E-56 40 249

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0005634 nucleus Yes
GO:0006338 chromatin remodeling Yes
GO:0043486 histone exchange Yes
GO:0080090 regulation of primary metabolic process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0005575 cellular_component No
GO:0043227 membrane-bounded organelle No
GO:0043226 organelle No
GO:0071840 cellular component organization or biogenesis No
GO:0043231 intracellular membrane-bounded organelle No
GO:0031326 regulation of cellular biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031323 regulation of cellular metabolic process No
GO:0050794 regulation of cellular process No
GO:0043933 protein-containing complex organization No
GO:0071824 protein-DNA complex subunit organization No
GO:0043229 intracellular organelle No
GO:0034728 nucleosome organization No
GO:0006325 chromatin organization No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0051252 regulation of RNA metabolic process No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0065007 biological regulation No
GO:0016043 cellular component organization No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0008150 biological_process No
GO:0009889 regulation of biosynthetic process No
GO:0051171 regulation of nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1471 0.9474 0.1479 0.0436 0.0646 0.0151 0.0151 0.0066 0.0084 0.0085

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
YL1 nuclear protein

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4936
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|757
Ophiocordyceps camponoti-floridani Ophcf2|06025 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7051
Ophiocordyceps kimflemingae Ophio5|7747
Ophiocordyceps subramaniannii Hirsu2|1784

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06025
MAATDTESKAADGSASQPASDSDSDSSDETPATEWLATTRQRRSTAGNRIKSMLAAEEPDSDLELLFAEAEDDEG
FSVAAGDEAAASDVQMDSSSTDSDDDGGDDDHEGEKELERQCQARRAAQRKKSAREAIPVKFRKRVRIDDASTTE
RRPKKKAKVERGSWLPSPADAPTRASSRQTTRSSKEQLHQQMVEREARRLRQLALTQKKAAKLAASKKAPMTQAE
RLAEAAMVEKANGRSLNRWEEAEKFEADDDDDDDDDDDDDDNYIQQRPTPPPAMAMPPPPRPSSVLAAPILAAPT
LSPPIGTKTSEGTGAHMSVLALPNTSSPHDQQHRQQPGGAVTKMIGGGEEEGGGGGGGAGGMKMTGTEEEVEVEV
EVLSARNAVVFQNFDGNAIRDKAVQTQILFGRKMVKLHKRPQPPAR*
Coding >Ophcf2|06025
ATGGCCGCCACGGATACGGAATCGAAGGCAGCGGACGGTTCCGCATCTCAGCCGGCGTCCGATAGCGATAGCGAC
AGTTCAGACGAGACGCCGGCGACAGAATGGCTCGCGACGACACGACAGCGGCGATCGACGGCCGGCAACCGCATC
AAGTCGATGCTGGCGGCGGAAGAGCCAGACTCGGACCTGGAGCTCCTCTTCGCCGAAGCCGAGGATGACGAGGGC
TTCTCCGTTGCAGCCGGCGACGAGGCGGCGGCGTCGGATGTGCAGATGGACTCTTCCTCTACCGACTCGGACGAC
GACGGCGGCGACGATGACCACGAGGGAGAGAAGGAGCTCGAGCGGCAATGTCAAGCCCGGAGAGCGGCTCAGCGA
AAGAAATCCGCGCGTGAAGCCATCCCCGTCAAGTTTCGGAAAAGGGTGCGCATCGACGACGCGTCGACGACGGAG
CGACGACCCAAGAAGAAGGCCAAGGTCGAGCGCGGCTCCTGGCTCCCCTCCCCAGCCGACGCCCCGACGCGAGCC
TCTTCCCGACAGACGACGCGGTCATCGAAAGAACAGCTCCATCAGCAGATGGTCGAGCGCGAGGCCCGTCGACTA
CGACAGCTGGCGCTGACGCAAAAGAAGGCGGCCAAGCTGGCGGCGAGCAAGAAGGCGCCCATGACGCAGGCCGAG
AGGCTCGCGGAGGCGGCCATGGTGGAGAAGGCGAATGGCAGGAGCTTGAATCGGTGGGAGGAGGCGGAGAAGTTT
GAAGCCGACGACGACGACGACGACGACGACGACGACGACGACGACGACAACTACATCCAGCAACGGCCCACGCCC
CCCCCAGCAATGGCGATGCCTCCCCCCCCCCGACCCTCAAGCGTCCTCGCCGCCCCCATCCTCGCCGCCCCCACG
CTCTCCCCCCCGATCGGCACCAAGACGAGCGAGGGGACGGGCGCCCACATGAGCGTCCTGGCGCTGCCCAACACG
TCGTCGCCTCACGACCAGCAGCATCGTCAGCAGCCGGGCGGTGCGGTCACCAAGATGATTGGTGGTGGTGAAGAA
GAAGGAGGAGGAGGAGGAGGAGGAGCTGGCGGGATGAAGATGACGGGGACGGAGGAGGAGGTCGAGGTTGAGGTC
GAGGTGCTTTCGGCGAGGAATGCCGTCGTCTTTCAGAATTTCGATGGCAATGCTATTCGCGACAAGGCGGTGCAG
ACTCAGATTCTCTTTGGTCGCAAAATGGTCAAACTGCATAAACGCCCCCAACCCCCTGCGCGATAA
Transcript >Ophcf2|06025
ATGGCCGCCACGGATACGGAATCGAAGGCAGCGGACGGTTCCGCATCTCAGCCGGCGTCCGATAGCGATAGCGAC
AGTTCAGACGAGACGCCGGCGACAGAATGGCTCGCGACGACACGACAGCGGCGATCGACGGCCGGCAACCGCATC
AAGTCGATGCTGGCGGCGGAAGAGCCAGACTCGGACCTGGAGCTCCTCTTCGCCGAAGCCGAGGATGACGAGGGC
TTCTCCGTTGCAGCCGGCGACGAGGCGGCGGCGTCGGATGTGCAGATGGACTCTTCCTCTACCGACTCGGACGAC
GACGGCGGCGACGATGACCACGAGGGAGAGAAGGAGCTCGAGCGGCAATGTCAAGCCCGGAGAGCGGCTCAGCGA
AAGAAATCCGCGCGTGAAGCCATCCCCGTCAAGTTTCGGAAAAGGGTGCGCATCGACGACGCGTCGACGACGGAG
CGACGACCCAAGAAGAAGGCCAAGGTCGAGCGCGGCTCCTGGCTCCCCTCCCCAGCCGACGCCCCGACGCGAGCC
TCTTCCCGACAGACGACGCGGTCATCGAAAGAACAGCTCCATCAGCAGATGGTCGAGCGCGAGGCCCGTCGACTA
CGACAGCTGGCGCTGACGCAAAAGAAGGCGGCCAAGCTGGCGGCGAGCAAGAAGGCGCCCATGACGCAGGCCGAG
AGGCTCGCGGAGGCGGCCATGGTGGAGAAGGCGAATGGCAGGAGCTTGAATCGGTGGGAGGAGGCGGAGAAGTTT
GAAGCCGACGACGACGACGACGACGACGACGACGACGACGACGACGACAACTACATCCAGCAACGGCCCACGCCC
CCCCCAGCAATGGCGATGCCTCCCCCCCCCCGACCCTCAAGCGTCCTCGCCGCCCCCATCCTCGCCGCCCCCACG
CTCTCCCCCCCGATCGGCACCAAGACGAGCGAGGGGACGGGCGCCCACATGAGCGTCCTGGCGCTGCCCAACACG
TCGTCGCCTCACGACCAGCAGCATCGTCAGCAGCCGGGCGGTGCGGTCACCAAGATGATTGGTGGTGGTGAAGAA
GAAGGAGGAGGAGGAGGAGGAGGAGCTGGCGGGATGAAGATGACGGGGACGGAGGAGGAGGTCGAGGTTGAGGTC
GAGGTGCTTTCGGCGAGGAATGCCGTCGTCTTTCAGAATTTCGATGGCAATGCTATTCGCGACAAGGCGGTGCAG
ACTCAGATTCTCTTTGGTCGCAAAATGGTCAAACTGCATAAACGCCCCCAACCCCCTGCGCGATAA
Gene >Ophcf2|06025
ATGGCCGCCACGGATACGGAATCGAAGGCAGCGGACGGTTCCGCATCTCAGCCGGCGTCCGATAGCGATAGCGAC
AGTTCAGACGAGACGCCGGCGACAGAATGGCTCGCGACGACACGACAGCGGCGATCGACGGCCGGCAACCGCATC
AAGTCGATGCTGGCGGCGGAAGAGCCAGACTCGGACCTGGAGCTCCTCTTCGCCGAAGCCGAGGATGACGAGGGC
TTCTCCGTTGCAGCCGGCGACGAGGCGGCGGCGTCGGATGTGCAGATGGACTCTTCCTCTACCGACTCGGACGAC
GACGGCGGCGACGATGACCACGAGGGAGAGAAGGAGCTCGAGCGGCAATGTCAAGCCCGGAGAGCGGCTCAGCGA
AAGAAATCCGCGCGTGAAGCCATCCCCGTCAAGTTTCGGAAAAGGGTGCGCATCGACGACGCGTCGACGACGGAG
CGACGACCCAAGAAGAAGGCCAAGGTCGAGCGCGGCTCCTGGCTCCCCTCCCCAGCCGACGCCCCGACGCGAGCC
TCTTCCCGACAGACGACGCGGTCATCGAAAGAACAGCTCCATCAGCAGATGGTCGAGCGCGAGGCCCGTCGACTA
CGACAGCTGGCGCTGACGCAAAAGAAGGCGGCCAAGCTGGCGGCGAGCAAGAAGGCGCCCATGACGCAGGCCGAG
AGGCTCGCGGAGGCGGCCATGGTGGAGAAGGCGAATGGCAGGAGCTTGAATCGGTGGGAGGAGGCGGAGAAGGTG
AGGGAGGGGGAGAGGAGGGCTAAGCTTGCGGCTTTGAACGATCGGACGCTCGGGGGCCCGGTTGTGACTTTTGGA
GCGGTGTTCGGAGGGGGAGGGATGAGGGAAGGGAGGGTTGCTGTTGTTGAGGGAAGGGAAGAGGAAGAAGAGGGA
TGGGAAGGGATGGGGATGGGGATGGGGAAGTCTTTGGAGGTGACGACGAGCACGAGTTTGAAGCCGACGACGACG
ACGACGACGACGACGACGACGACGACGACGACAACTACATCCAGCAACGGCCCACGCCCCCCCCAGCAATGGCGA
TGCCTCCCCCCCCCCGACCCTCAAGCGTCCTCGCCGCCCCCATCCTCGCCGCCCCCACGCTCTCCCCCCCGATCG
GCACCAAGACGAGCGAGGGGACGGGCGCCCACATGAGCGTCCTGGCGCTGCCCAACACGTCGTCGCCTCACGACC
AGCAGCATCGTCAGCAGCCGGGCGGTGCGGTCACCAAGATGATTGGTGGTGGTGAAGAAGAAGGAGGAGGAGGAG
GAGGAGGAGCTGGCGGGATGAAGATGACGGGGACGGAGGAGGAGGTCGAGGTTGAGGTCGAGGTGCTTTCGGCGA
GGAATGCCGTCGTCTTTCAGAATTTCGATGGCAATGCTATTCGCGACAAGGCGGTGCAGACTCAGATTCTCTTTG
GTCGCAAAATGGTCAAACTGCATAGTGAGTCCTCTCCCTTTTCTTTTCTTTTTTCCTTTTGCTCTGCCTCTTTCT
CTGCCTCTTTCTCTTTCTCCTCCTCTTCCTCCTCCTCTTCCTCCTCCTCTTCCTCCTCCTCTACCTCGCCTCCCT
CCCTCCCCCCCCATCCCCATCCCCATCCCCATCCCCATCCTCACCTCACCTCCCACCTCTCCCCATCACAGAACC
CCAAGCTAACGAAGCAGAACGCCCCCAACCCCCTGCGCGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail