Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06024
Gene name
Locationscaffold_07:433650..435299
Strand+
Gene length (bp)1649
Transcript length (bp)1326
Coding sequence length (bp)1326
Protein length (aa) 442

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.776 0.3596 0.1845 0.1853 0.1028 0.0157 0.2499 0.1196 0.1688 0.0573

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2500
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1502
Ophiocordyceps australis map64 (Brazil) OphauB2|756
Ophiocordyceps camponoti-floridani Ophcf2|06024 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6835
Ophiocordyceps kimflemingae Ophio5|391
Ophiocordyceps subramaniannii Hirsu2|3623

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06024
MDPTTTLITFLLQTDPSVQSVNLIGSWDGFSAWYAMKPDVRRGRGQWRGCYSFKDIICDDESAVARRHGGLKMGA
TYYYYYEVDGSLETHDPAEPCTTACPYLPGQTVNTLSVPVERSERHRSASLNSLHPDGFKTMNPDAKFDTPCPPD
APPAAEAAASRRLASAPGLPRALIPAPPTSWARFFSRKLSSRSPYDGGIPSSSLSDAAGGSIAPRARDESPESPR
RLVCEHVTPTRFDSARPPPSLFIPEDIAEEADDDDYDDYDDDCFATSPLADKQPYMTYRCPPPIRRYASTDAMAN
ASTHTLRPAPPPIAGVPLAKMDAGSRQMRWSMSATSQSMEEDPPSFYDSYDEDEVMSSTDGDNFSHVPLPSLSSS
AERAFKVYSLPQDEVKADCASLRSPRLLARSDSTAAAAAANLLGADTGLDDLVSELGWMIDVIGSK*
Coding >Ophcf2|06024
ATGGATCCTACCACGACGCTCATCACCTTTCTACTACAGACGGATCCTTCGGTTCAGTCGGTAAACCTCATTGGC
TCCTGGGATGGCTTCTCCGCCTGGTACGCCATGAAGCCCGACGTCCGTCGCGGTCGAGGCCAATGGAGAGGTTGT
TATTCCTTCAAAGACATCATTTGCGACGATGAGTCCGCCGTCGCTCGTCGTCATGGTGGCCTCAAGATGGGCGCC
ACCTATTATTACTACTACGAGGTGGATGGCTCCCTCGAGACGCACGATCCTGCCGAGCCCTGCACCACGGCCTGT
CCCTATCTCCCCGGTCAGACGGTCAACACGCTGAGCGTCCCGGTCGAGCGATCGGAGCGCCACCGCAGCGCCTCG
CTAAACTCCCTGCACCCCGATGGCTTCAAGACGATGAATCCCGACGCCAAGTTCGACACGCCCTGTCCGCCCGAC
GCCCCCCCCGCTGCCGAGGCTGCCGCCTCCCGCCGACTGGCTTCGGCCCCGGGCCTCCCTCGAGCTCTCATTCCT
GCTCCGCCTACGTCTTGGGCGCGCTTCTTCAGCCGCAAGCTGTCGAGCCGCAGCCCCTACGACGGCGGCATCCCC
TCCTCCTCGCTCTCGGACGCCGCGGGTGGCTCCATCGCCCCCCGCGCCAGGGACGAATCTCCCGAGTCGCCGCGC
CGGCTCGTGTGCGAGCATGTAACCCCGACTCGATTCGACTCGGCTCGTCCGCCCCCGAGTCTGTTCATACCCGAG
GATATAGCCGAAGAGGCCGACGACGACGACTACGACGACTATGACGACGACTGCTTTGCCACGTCGCCCCTCGCG
GACAAGCAGCCCTACATGACGTATCGGTGCCCGCCTCCCATCCGGCGCTACGCATCGACGGACGCCATGGCCAAT
GCAAGCACCCATACGCTCAGGCCGGCCCCGCCACCGATTGCCGGCGTCCCCTTGGCCAAGATGGATGCCGGCTCG
CGGCAGATGCGCTGGTCCATGTCTGCCACGTCGCAATCCATGGAGGAGGATCCGCCGTCGTTTTACGATTCCTAC
GACGAGGACGAGGTCATGTCGAGCACCGACGGCGACAACTTTTCGCACGTGCCGCTGCCGAGCCTGTCGTCGTCG
GCCGAGAGGGCCTTTAAGGTTTACAGCCTGCCGCAGGACGAGGTCAAGGCCGATTGCGCCAGCCTCCGATCTCCG
CGACTCCTGGCCCGCAGTGACTCTACGGCGGCGGCGGCGGCGGCCAACCTGCTGGGCGCAGACACGGGGCTGGAC
GACCTGGTCAGCGAGCTCGGCTGGATGATCGACGTCATCGGCAGCAAGTGA
Transcript >Ophcf2|06024
ATGGATCCTACCACGACGCTCATCACCTTTCTACTACAGACGGATCCTTCGGTTCAGTCGGTAAACCTCATTGGC
TCCTGGGATGGCTTCTCCGCCTGGTACGCCATGAAGCCCGACGTCCGTCGCGGTCGAGGCCAATGGAGAGGTTGT
TATTCCTTCAAAGACATCATTTGCGACGATGAGTCCGCCGTCGCTCGTCGTCATGGTGGCCTCAAGATGGGCGCC
ACCTATTATTACTACTACGAGGTGGATGGCTCCCTCGAGACGCACGATCCTGCCGAGCCCTGCACCACGGCCTGT
CCCTATCTCCCCGGTCAGACGGTCAACACGCTGAGCGTCCCGGTCGAGCGATCGGAGCGCCACCGCAGCGCCTCG
CTAAACTCCCTGCACCCCGATGGCTTCAAGACGATGAATCCCGACGCCAAGTTCGACACGCCCTGTCCGCCCGAC
GCCCCCCCCGCTGCCGAGGCTGCCGCCTCCCGCCGACTGGCTTCGGCCCCGGGCCTCCCTCGAGCTCTCATTCCT
GCTCCGCCTACGTCTTGGGCGCGCTTCTTCAGCCGCAAGCTGTCGAGCCGCAGCCCCTACGACGGCGGCATCCCC
TCCTCCTCGCTCTCGGACGCCGCGGGTGGCTCCATCGCCCCCCGCGCCAGGGACGAATCTCCCGAGTCGCCGCGC
CGGCTCGTGTGCGAGCATGTAACCCCGACTCGATTCGACTCGGCTCGTCCGCCCCCGAGTCTGTTCATACCCGAG
GATATAGCCGAAGAGGCCGACGACGACGACTACGACGACTATGACGACGACTGCTTTGCCACGTCGCCCCTCGCG
GACAAGCAGCCCTACATGACGTATCGGTGCCCGCCTCCCATCCGGCGCTACGCATCGACGGACGCCATGGCCAAT
GCAAGCACCCATACGCTCAGGCCGGCCCCGCCACCGATTGCCGGCGTCCCCTTGGCCAAGATGGATGCCGGCTCG
CGGCAGATGCGCTGGTCCATGTCTGCCACGTCGCAATCCATGGAGGAGGATCCGCCGTCGTTTTACGATTCCTAC
GACGAGGACGAGGTCATGTCGAGCACCGACGGCGACAACTTTTCGCACGTGCCGCTGCCGAGCCTGTCGTCGTCG
GCCGAGAGGGCCTTTAAGGTTTACAGCCTGCCGCAGGACGAGGTCAAGGCCGATTGCGCCAGCCTCCGATCTCCG
CGACTCCTGGCCCGCAGTGACTCTACGGCGGCGGCGGCGGCGGCCAACCTGCTGGGCGCAGACACGGGGCTGGAC
GACCTGGTCAGCGAGCTCGGCTGGATGATCGACGTCATCGGCAGCAAGTGA
Gene >Ophcf2|06024
ATGGATCCTACCACGACGCTCATCACCTTTCTACTGTGAGTTTTGCCAGTGTTTCCTCCTCCCCTCGCAGCCTGC
ACGTCTCGTCCAAGAACAAGATGCCAAAAGAAGAAAAAACAAACAAGAAACGAAGGCCGTCTTATCCCCCCTGAG
AATGTTCGCTTTCCTTCATTGGCTCTTCCCGTCTTTAGGCTCGTTTCACTAGTTGTCTTGACCGCCCATTGAGGG
TCTATTCTGCCCGTAATACGTCCGATCCTTTCATTCCCTCATCCAATGATGGTAAGCTGACGCTCTGCACTCAGA
CAGACGGATCCTTCGGTTCAGTCGGTAAACCTCATTGGCTCCTGGGATGGCTTCTCCGCCTGGTACGCCATGAAG
CCCGACGTCCGTCGCGGTCGAGGCCAATGGAGAGGTTGTTATTCCTTCAAAGACATCATTTGCGACGATGAGTCC
GCCGTCGCTCGTCGTCATGGTGGCCTCAAGATGGGCGCCACCTATTATTACTACGTGAGCTTCCTGACCGTCATT
CTCGCCTCCTTCACGGTGGCTGAAAGTGTCTTCGCCAGTACGAGGTGGATGGCTCCCTCGAGACGCACGATCCTG
CCGAGCCCTGCACCACGGCCTGTCCCTATCTCCCCGGTCAGACGGTCAACACGCTGAGCGTCCCGGTCGAGCGAT
CGGAGCGCCACCGCAGCGCCTCGCTAAACTCCCTGCACCCCGATGGCTTCAAGACGATGAATCCCGACGCCAAGT
TCGACACGCCCTGTCCGCCCGACGCCCCCCCCGCTGCCGAGGCTGCCGCCTCCCGCCGACTGGCTTCGGCCCCGG
GCCTCCCTCGAGCTCTCATTCCTGCTCCGCCTACGTCTTGGGCGCGCTTCTTCAGCCGCAAGCTGTCGAGCCGCA
GCCCCTACGACGGCGGCATCCCCTCCTCCTCGCTCTCGGACGCCGCGGGTGGCTCCATCGCCCCCCGCGCCAGGG
ACGAATCTCCCGAGTCGCCGCGCCGGCTCGTGTGCGAGCATGTAACCCCGACTCGATTCGACTCGGCTCGTCCGC
CCCCGAGTCTGTTCATACCCGAGGATATAGCCGAAGAGGCCGACGACGACGACTACGACGACTATGACGACGACT
GCTTTGCCACGTCGCCCCTCGCGGACAAGCAGCCCTACATGACGTATCGGTGCCCGCCTCCCATCCGGCGCTACG
CATCGACGGACGCCATGGCCAATGCAAGCACCCATACGCTCAGGCCGGCCCCGCCACCGATTGCCGGCGTCCCCT
TGGCCAAGATGGATGCCGGCTCGCGGCAGATGCGCTGGTCCATGTCTGCCACGTCGCAATCCATGGAGGAGGATC
CGCCGTCGTTTTACGATTCCTACGACGAGGACGAGGTCATGTCGAGCACCGACGGCGACAACTTTTCGCACGTGC
CGCTGCCGAGCCTGTCGTCGTCGGCCGAGAGGGCCTTTAAGGTTTACAGCCTGCCGCAGGACGAGGTCAAGGCCG
ATTGCGCCAGCCTCCGATCTCCGCGACTCCTGGCCCGCAGTGACTCTACGGCGGCGGCGGCGGCGGCCAACCTGC
TGGGCGCAGACACGGGGCTGGACGACCTGGTCAGCGAGCTCGGCTGGATGATCGACGTCATCGGCAGCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail