Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06023
Gene name
Locationscaffold_07:429364..430536
Strand+
Gene length (bp)1172
Transcript length (bp)1074
Coding sequence length (bp)1074
Protein length (aa) 358

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04116 FA_hydroxylase Fatty acid hydroxylase 1.0E-22 202 337

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0008610 lipid biosynthetic process Yes
GO:0005506 iron ion binding Yes
GO:0006629 lipid metabolic process No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0046914 transition metal ion binding No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 189 211 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 28.50 13.83 43.17
Alive In ants, during behavior modification 94.42 51.61 137.23
Dead In ants, recently dead 134.60 76.08 193.11

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.031829 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06023
MAASQNHTLLAGALPPLPLYSLEPTGDVFDCISDFWLSLLLPIIVYWAASLLFHVIDVWDLFPQYRLHTPDEIVR
RNHAGRFEVARDVVVQQVIQVVTGAALALTEPAEMRGKAEYDVAVWASRLRIAQRALPALLRLLGLNAAAISKSV
SSSHPLLARALAGGGFSPELDAPNLGVPAFAPWELTAASVVYYVLVPVLQFFAAIFVLDTWQYFLHRLMHVNRWL
YTTFHSRHHRLYVPYAYGALYNHPFEGFLLDTLGAGIAFKLTGMTLRQGTCFFAFSTLKTVDDHCGYAFPWDPLQ
HITSNNAAYHDIHHQTWGIKSNFSQPFFTFWDSLLNTKYKGRRGDRLADRKRAGETK*
Coding >Ophcf2|06023
ATGGCCGCATCTCAGAACCACACGCTTTTGGCTGGCGCGCTGCCGCCTCTGCCCCTGTACAGTCTCGAGCCGACG
GGTGACGTCTTCGACTGCATCTCCGACTTTTGGCTATCGCTCCTCCTGCCCATCATCGTCTACTGGGCTGCCTCG
CTGCTGTTTCACGTCATCGATGTCTGGGACCTCTTCCCCCAGTATCGACTCCATACGCCAGATGAGATCGTCCGG
CGCAACCACGCCGGTCGGTTCGAGGTGGCGCGCGACGTGGTGGTGCAACAGGTTATACAAGTCGTCACCGGCGCT
GCCCTCGCCCTGACCGAACCGGCCGAGATGCGTGGCAAGGCCGAGTACGACGTGGCGGTGTGGGCCAGCCGTCTT
CGCATCGCTCAGCGCGCCCTCCCAGCCCTGCTACGGCTGCTGGGCCTCAACGCCGCCGCCATCTCCAAGAGCGTG
TCGTCTTCGCATCCTCTGCTGGCCCGCGCCCTAGCCGGCGGCGGCTTCTCGCCCGAGCTCGACGCTCCCAACCTC
GGCGTCCCGGCCTTTGCCCCCTGGGAGTTGACGGCGGCCAGCGTCGTCTACTACGTGCTCGTCCCGGTGCTGCAG
TTCTTCGCCGCCATCTTCGTCCTCGATACCTGGCAATACTTTCTCCATCGGCTCATGCACGTGAACCGCTGGCTG
TATACCACGTTCCACTCGCGGCACCATCGGCTTTATGTTCCGTACGCCTACGGGGCGCTTTACAACCATCCCTTT
GAGGGTTTTCTTCTCGACACGCTCGGGGCGGGCATCGCCTTTAAGCTCACGGGCATGACGCTGCGTCAGGGCACC
TGCTTCTTCGCCTTCTCCACGCTCAAGACGGTCGACGACCACTGCGGCTATGCGTTCCCCTGGGACCCCTTGCAG
CACATAACGAGTAACAATGCTGCCTATCACGACATCCACCACCAGACGTGGGGAATCAAGAGCAACTTTTCGCAG
CCCTTTTTCACCTTTTGGGATTCGCTGCTCAACACGAAATACAAGGGCCGGCGAGGCGACCGGTTGGCGGATAGG
AAGCGCGCCGGGGAGACCAAGTAA
Transcript >Ophcf2|06023
ATGGCCGCATCTCAGAACCACACGCTTTTGGCTGGCGCGCTGCCGCCTCTGCCCCTGTACAGTCTCGAGCCGACG
GGTGACGTCTTCGACTGCATCTCCGACTTTTGGCTATCGCTCCTCCTGCCCATCATCGTCTACTGGGCTGCCTCG
CTGCTGTTTCACGTCATCGATGTCTGGGACCTCTTCCCCCAGTATCGACTCCATACGCCAGATGAGATCGTCCGG
CGCAACCACGCCGGTCGGTTCGAGGTGGCGCGCGACGTGGTGGTGCAACAGGTTATACAAGTCGTCACCGGCGCT
GCCCTCGCCCTGACCGAACCGGCCGAGATGCGTGGCAAGGCCGAGTACGACGTGGCGGTGTGGGCCAGCCGTCTT
CGCATCGCTCAGCGCGCCCTCCCAGCCCTGCTACGGCTGCTGGGCCTCAACGCCGCCGCCATCTCCAAGAGCGTG
TCGTCTTCGCATCCTCTGCTGGCCCGCGCCCTAGCCGGCGGCGGCTTCTCGCCCGAGCTCGACGCTCCCAACCTC
GGCGTCCCGGCCTTTGCCCCCTGGGAGTTGACGGCGGCCAGCGTCGTCTACTACGTGCTCGTCCCGGTGCTGCAG
TTCTTCGCCGCCATCTTCGTCCTCGATACCTGGCAATACTTTCTCCATCGGCTCATGCACGTGAACCGCTGGCTG
TATACCACGTTCCACTCGCGGCACCATCGGCTTTATGTTCCGTACGCCTACGGGGCGCTTTACAACCATCCCTTT
GAGGGTTTTCTTCTCGACACGCTCGGGGCGGGCATCGCCTTTAAGCTCACGGGCATGACGCTGCGTCAGGGCACC
TGCTTCTTCGCCTTCTCCACGCTCAAGACGGTCGACGACCACTGCGGCTATGCGTTCCCCTGGGACCCCTTGCAG
CACATAACGAGTAACAATGCTGCCTATCACGACATCCACCACCAGACGTGGGGAATCAAGAGCAACTTTTCGCAG
CCCTTTTTCACCTTTTGGGATTCGCTGCTCAACACGAAATACAAGGGCCGGCGAGGCGACCGGTTGGCGGATAGG
AAGCGCGCCGGGGAGACCAAGTAA
Gene >Ophcf2|06023
ATGGCCGCATCTCAGAACCACACGCTTTTGGCTGGCGCGCTGCCGCCTCTGCCCCTGTACAGTCTCGAGCCGACG
GGTGACGTCTTCGACTGCATCTCCGACTTTTGGCTATCGCTCCTCCTGCCCATCATCGTCTACTGGGCTGCCTCG
CTGCTGTTTCACGTCATCGATGTCTGGGACCTCTTCCCCCAGTATCGACTCCATACGCCAGATGAGATCGTCCGG
CGCAACCACGCCGGTCGGTTCGAGGTGGCGCGCGACGTGGTGGTGCAACAGGTTATACAAGTCGTCACCGGCGCT
GCCCTCGCCCTGACCGAACCGGCCGAGATGCGTGGCAAGGCCGAGTACGACGTGGCGGTGTGGGCCAGCCGTCTT
CGCATCGCTCAGCGCGCCCTCCCAGCCCTGCTACGGCTGCTGGGCCTCAACGCCGCCGCCATCTCCAAGAGCGTG
TCGTCTTCGCATCCTCTGCTGGCCCGCGCCCTAGCCGGCGGCGGCTTCTCGCCCGAGCTCGACGCTCCCAACCTC
GGCGTCCCGGCCTTTGCCCCCTGGGAGTTGACGGCGGCCAGCGTCGTCTACTACGTGCTCGTCCCGGTGCTGCAG
TTCTTCGCCGCCATCTTCGTCCTCGATACCTGGCAATACTTTCTCCATCGGCTCATGCACGTGAACCGCTGGCTG
TATAGTGAGTCGCCTCCCTTAACCCTTGCACAACAGCATGTCCTCTTGCCTGCCGTGAATCCCCATTCTTCCGTC
GGCGGCTGACAGGAAACGTCGTGTCAGCCACGTTCCACTCGCGGCACCATCGGCTTTATGTTCCGTACGCCTACG
GGGCGCTTTACAACCATCCCTTTGAGGGTTTTCTTCTCGACACGCTCGGGGCGGGCATCGCCTTTAAGCTCACGG
GCATGACGCTGCGTCAGGGCACCTGCTTCTTCGCCTTCTCCACGCTCAAGACGGTCGACGACCACTGCGGCTATG
CGTTCCCCTGGGACCCCTTGCAGCACATAACGAGTAACAATGCTGCCTATCACGACATCCACCACCAGACGTGGG
GAATCAAGAGCAACTTTTCGCAGCCCTTTTTCACCTTTTGGGATTCGCTGCTCAACACGAAATACAAGGGCCGGC
GAGGCGACCGGTTGGCGGATAGGAAGCGCGCCGGGGAGACCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail