Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06022
Gene name
Locationscaffold_07:427600..428337
Strand-
Gene length (bp)737
Transcript length (bp)516
Coding sequence length (bp)516
Protein length (aa) 172

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00838 TCTP Translationally controlled tumour protein 5.9E-72 1 166

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.811 0.6057 0.1273 0.0933 0.2365 0.0112 0.0862 0.0883 0.0399 0.0107

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2371
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|666
Ophiocordyceps australis map64 (Brazil) OphauB2|754
Ophiocordyceps camponoti-floridani Ophcf2|06022 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1254
Ophiocordyceps kimflemingae Ophio5|7115
Ophiocordyceps subramaniannii Hirsu2|3315

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06022
MIIFKDILTDDEIISDSYELKEVDGIVYEADCAMITEQAVQADIGANASAEGGDEEGVEDQAVKVNNIVHSFRLQ
STSFDKKGYLAYLKGYMKAVKAKLQEKNAPADTITAFEKGAQAYVKEKLLPSFKDFEFYTGESMNPDGLVVLLNY
REDGVTPYVIVWKHGLSEMKV*
Coding >Ophcf2|06022
ATGATCATCTTCAAGGATATCCTCACCGACGACGAGATCATCTCCGACTCGTATGAGCTCAAGGAAGTCGATGGC
ATCGTCTACGAGGCCGACTGCGCCATGATCACCGAGCAGGCTGTTCAGGCTGATATTGGCGCCAACGCTTCTGCC
GAGGGTGGTGACGAGGAGGGCGTCGAGGACCAGGCCGTCAAGGTGAATAACATTGTTCACTCTTTCCGCCTTCAG
TCGACCTCTTTCGATAAGAAGGGCTACCTCGCATATCTCAAGGGCTACATGAAGGCCGTCAAGGCCAAGCTCCAA
GAGAAGAATGCCCCCGCCGACACAATTACCGCCTTCGAAAAGGGCGCTCAGGCCTACGTCAAGGAGAAGCTGCTG
CCCAGCTTCAAGGACTTTGAGTTTTACACGGGCGAATCCATGAATCCCGATGGACTCGTTGTTCTGCTCAACTAC
CGCGAGGACGGCGTGACGCCCTACGTCATCGTATGGAAGCATGGCCTGTCGGAGATGAAGGTCTGA
Transcript >Ophcf2|06022
ATGATCATCTTCAAGGATATCCTCACCGACGACGAGATCATCTCCGACTCGTATGAGCTCAAGGAAGTCGATGGC
ATCGTCTACGAGGCCGACTGCGCCATGATCACCGAGCAGGCTGTTCAGGCTGATATTGGCGCCAACGCTTCTGCC
GAGGGTGGTGACGAGGAGGGCGTCGAGGACCAGGCCGTCAAGGTGAATAACATTGTTCACTCTTTCCGCCTTCAG
TCGACCTCTTTCGATAAGAAGGGCTACCTCGCATATCTCAAGGGCTACATGAAGGCCGTCAAGGCCAAGCTCCAA
GAGAAGAATGCCCCCGCCGACACAATTACCGCCTTCGAAAAGGGCGCTCAGGCCTACGTCAAGGAGAAGCTGCTG
CCCAGCTTCAAGGACTTTGAGTTTTACACGGGCGAATCCATGAATCCCGATGGACTCGTTGTTCTGCTCAACTAC
CGCGAGGACGGCGTGACGCCCTACGTCATCGTATGGAAGCATGGCCTGTCGGAGATGAAGGTCTGA
Gene >Ophcf2|06022
ATGATCATCTTCAAGGTTGGCCGCACCCCGCAGTTCGTCTCTAGCAAGCCGCTGACGTACCTTTAGGATATCCTC
ACCGACGACGAGATCATCTCCGACTCGTATGAGCTCAAGGAAGTCGATGGCATCGTCTACGAGGCCGACTGCGCC
ATGATCACCGAGCAGGCTGTTCAGGCTGGTGCGATGTTTTGCGCCGACTTTCGATCTGCTTGCGCTGATATTTTT
CCTTTGGCTTAGATATTGGCGCCAACGCTTCTGCCGAGGGTGGTGACGAGGAGGGCGTCGAGGACCAGGCCGTCA
AGGTGAATAACATTGTTCACTCTTTCCGCCTTCAGTCGACCTCTTTCGATAAGAAGGGCTACCTCGCATATCTCA
AGGGTGCGCTCTCTTGGACTCGCGCTCATAACTATCCTCTCCCCTAACTCGCTCGACACAGGCTACATGAAGGCC
GTCAAGGCCAAGCTCCAAGAGAAGAATGCCCCCGCCGACACAATTACCGCCTTCGAAAAGGGCGCTCAGGCCTAC
GTCAAGGAGAAGCTGCTGCCCAGCTTCAAGGACTTTGAGTTTTACACGGGCGAATCCATGAATCCCGATGGACTG
TATGCCATTCTTTCTTTCCCTTACATGACACGGCTGGCTGACCATGATCCAGCGTTGTTCTGCTCAACTACCGCG
AGGACGGCGTGACGCCCTACGTCATCGTATGGAAGCATGGCCTGTCGGAGATGAAGGTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail