Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06016
Gene name
Locationscaffold_07:407479..410975
Strand+
Gene length (bp)3496
Transcript length (bp)3072
Coding sequence length (bp)3072
Protein length (aa) 1024

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10537 WAC_Acf1_DNA_bd ATP-utilising chromatin assembly and remodelling N-terminal 7.0E-37 23 123
PF02791 DDT DDT domain 1.5E-15 391 448
PF15613 WSD Williams-Beuren syndrome DDT (WSD), D-TOX E motif 2.2E-15 786 911
PF15612 WHIM1 WSTF, HB1, Itc1p, MBD9 motif 1 1.1E-07 592 625

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.199 0.9252 0.0756 0.0559 0.1012 0.0379 0.0484 0.0099 0.034 0.0022

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
DDT

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1572
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4877
Ophiocordyceps australis map64 (Brazil) OphauB2|749
Ophiocordyceps camponoti-floridani Ophcf2|06016 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6561
Ophiocordyceps kimflemingae Ophio5|6299
Ophiocordyceps subramaniannii Hirsu2|1165

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06016
MVLFKRKPVKFLSPPDIDDDAAEVWHIAQTGEVFITYEDYLSRMEFYKQRRFNDQITGHSGLTFFEAFTSELAGG
REVDLSFPEALKGPILRKVQFQTISRLDNLVDMIYDEFKHDFYPGEEVTVTVDGGDRVHGLVRDKTSFGPRILPD
GSHAQPMTRYLVNIKDTEEETMVTDEHICRDRGTFTKSMLRSFIKKTVIREAWTGAPWLVKHDYAAQHHIDTRVP
PQLRYDTKVQERRQLQAQKRATPHDANANGATTAAAAMNQGPVRLPELKPAPKSHKGKQGSQGAKGLKWPPTTSL
NGANGYGHHHHHHHHHHHHHSAADGHRAAGLRDPPSPPSPPPPPPPKYPIDDLLLEPKKGSTRPRISFMCRDPPV
DVEGRGTLHDRIDMASVGALLETWDTLNVYCEIFRLDSFTFDDFVEAMSVASDRVHVQLFEEIHCAVLKILVESE
SEGGRVCIALPDLGDDAADGDTAVGLQSPDPTPEPEPKPTGRATRSSLAKLEAERLAAEAAAAEEESIRAELASK
HRAEELLKEYDWIEHLRKRDFANGGWQRIIVGLLHQLSKKERREKACEELLLQLVPPNTMPTQEAVRQTYARLDI
NYRVRALQILCMLTMETKAVRAYMEDCSEAMTKYRKDRIEWQRQRKQAIEDLRQLNEERKTLMPDVTPPEYHPIK
EEDVKLADDSLLDREEDGEGEAGKSHKKRRSRGPTEKQRKREEERERKTRDKEKGRDGVKGAKGTTKLPPQQQKQ
YNKLLKEIQKREGIIKECEAEIGVIENDLREADCARTRVLGKDRFWNRYYWFERNGMPYGGLPNSSTAFAEYANG
CIWVQGPDELERTGYIDVPADVDDEYRARFDMTIAERKEREEDGTSVFNATQWGFICEPDDVDRLIRWLDPRGLN
ELKLRKELLNYRDKMATHMERRKKYLSEAETEVAAAAAAAAAADTGDKERRDESTKRTSSRIRDKTPETARYRCL
RWENTMALDVLGHLHAEQPPPPRPKKQSRKREAAGEAAGRGPAKTRRR*
Coding >Ophcf2|06016
ATGGTCCTCTTCAAGCGGAAACCCGTCAAGTTTCTATCGCCTCCGGATATTGACGATGACGCCGCAGAGGTCTGG
CACATCGCCCAGACCGGCGAGGTTTTCATCACCTACGAAGACTATCTGAGTCGCATGGAGTTTTACAAACAGCGC
CGCTTCAACGACCAGATCACCGGTCACTCGGGCCTTACCTTTTTCGAGGCCTTTACCAGCGAGCTCGCCGGAGGC
CGTGAGGTCGACCTCAGCTTCCCAGAGGCTCTCAAAGGGCCCATTCTGCGCAAGGTCCAGTTTCAGACCATCTCC
CGCCTCGACAACCTCGTCGACATGATATATGACGAGTTCAAGCACGACTTCTACCCCGGCGAGGAGGTCACCGTC
ACCGTCGACGGCGGCGACCGAGTCCACGGCCTGGTTCGCGACAAGACTTCGTTTGGGCCCCGCATCCTACCCGAC
GGATCCCACGCGCAGCCCATGACCCGCTATCTCGTCAACATCAAGGACACCGAGGAGGAGACCATGGTCACCGAC
GAGCACATCTGCCGCGACCGTGGCACCTTCACAAAGTCGATGCTGAGGTCCTTCATCAAGAAGACTGTCATTCGG
GAGGCCTGGACCGGCGCCCCGTGGCTCGTCAAACACGACTACGCCGCCCAGCACCACATCGACACCCGAGTGCCC
CCCCAGCTCCGCTACGACACAAAGGTCCAGGAGCGCCGACAGCTCCAGGCCCAGAAGCGTGCCACCCCCCACGAC
GCCAACGCAAACGGCGCCACCACCGCAGCCGCCGCCATGAACCAGGGCCCCGTCCGCCTACCCGAGCTCAAGCCC
GCGCCAAAGAGCCACAAGGGCAAGCAGGGCTCCCAGGGCGCAAAGGGCCTCAAGTGGCCCCCTACCACGTCGCTC
AACGGCGCCAACGGCTACGGCCACCACCATCATCATCATCACCACCACCACCACCACCACTCCGCCGCCGACGGC
CACCGCGCAGCCGGCCTGCGAGATCCGCCCTCGCCGCCGTCCCCGCCACCTCCTCCGCCTCCAAAGTATCCGATC
GACGACCTCCTGCTCGAGCCCAAAAAAGGCAGCACGCGGCCCCGAATCAGCTTCATGTGCAGGGACCCTCCCGTC
GACGTCGAGGGCCGCGGGACCTTGCACGACCGCATCGACATGGCATCCGTCGGCGCCCTCCTCGAGACGTGGGAC
ACGCTCAACGTCTACTGCGAAATCTTCCGTCTCGACTCCTTCACGTTTGACGACTTTGTCGAGGCCATGTCGGTG
GCCTCGGACCGCGTCCACGTCCAGCTGTTCGAGGAGATACACTGCGCCGTCCTCAAGATCCTCGTCGAGTCCGAG
TCCGAAGGTGGCAGGGTCTGCATCGCCCTCCCCGACTTGGGCGACGACGCCGCCGATGGAGACACCGCCGTCGGG
CTACAGAGCCCCGATCCCACGCCCGAGCCGGAGCCGAAGCCGACGGGGCGCGCCACCCGCAGCAGCCTCGCAAAG
CTCGAGGCCGAGCGGCTGGCGGCCGAGGCGGCAGCGGCCGAGGAGGAGAGCATCCGGGCCGAGCTCGCGTCCAAG
CACCGGGCCGAGGAGCTCCTCAAGGAATACGACTGGATCGAGCACCTGCGCAAGCGCGACTTTGCCAACGGCGGC
TGGCAGAGGATCATCGTCGGTCTGCTGCACCAGCTGTCCAAGAAGGAGCGCCGGGAGAAGGCCTGCGAGGAGCTG
CTGCTACAACTGGTGCCGCCCAACACGATGCCGACGCAGGAGGCGGTGCGCCAGACGTACGCCAGGCTCGACATC
AACTACCGCGTCCGGGCGCTTCAGATCCTCTGCATGCTGACCATGGAGACCAAGGCCGTCAGGGCTTACATGGAG
GACTGCAGCGAGGCCATGACCAAGTATCGCAAGGACAGGATCGAGTGGCAGAGGCAGCGGAAGCAGGCGATTGAG
GATCTCAGGCAGCTCAACGAGGAGCGAAAGACGTTGATGCCCGACGTGACGCCCCCCGAATACCACCCCATCAAG
GAAGAAGACGTCAAGTTGGCAGACGACTCTCTCTTGGATCGGGAGGAAGACGGAGAAGGCGAAGCGGGCAAGTCG
CACAAAAAGCGCCGAAGCCGCGGTCCGACGGAGAAGCAGCGCAAGCGCGAAGAGGAGAGGGAACGAAAGACGCGA
GACAAGGAAAAGGGGCGGGACGGCGTCAAGGGTGCCAAGGGGACGACGAAGCTGCCGCCTCAGCAGCAGAAGCAG
TACAACAAGCTGCTCAAGGAGATACAGAAGCGCGAGGGCATCATCAAGGAATGCGAAGCCGAAATCGGCGTCATC
GAAAACGACCTTCGCGAGGCCGACTGCGCCAGGACGCGGGTCCTTGGCAAGGATCGCTTCTGGAACCGGTACTAC
TGGTTCGAACGCAACGGCATGCCCTACGGTGGACTCCCCAACAGCTCAACGGCATTTGCCGAGTACGCCAACGGC
TGCATCTGGGTGCAGGGCCCGGACGAGCTGGAGCGGACGGGCTACATCGACGTGCCGGCCGACGTCGACGACGAG
TACCGGGCGCGGTTCGACATGACGATAGCCGAACGCAAAGAGCGTGAGGAGGACGGGACGAGCGTCTTCAACGCG
ACGCAGTGGGGCTTCATCTGCGAGCCCGACGACGTGGACCGGCTGATACGCTGGCTGGACCCGCGCGGTCTCAAC
GAGCTGAAACTGCGCAAGGAGCTCCTCAACTACCGCGACAAGATGGCGACGCACATGGAGAGGCGTAAGAAGTAC
CTGTCGGAGGCCGAGACCGAGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCCGATACGGGCGACAAGGAGCGG
CGAGACGAGTCGACGAAGCGGACAAGCTCGCGGATCCGAGACAAGACGCCGGAGACGGCGCGGTACCGATGCCTG
CGATGGGAGAACACGATGGCGCTCGATGTACTGGGCCACCTGCACGCGGAGCAGCCACCGCCACCGCGACCGAAG
AAGCAGTCGAGGAAGAGGGAGGCGGCTGGCGAAGCGGCGGGACGAGGGCCGGCCAAGACGAGGCGGCGATAG
Transcript >Ophcf2|06016
ATGGTCCTCTTCAAGCGGAAACCCGTCAAGTTTCTATCGCCTCCGGATATTGACGATGACGCCGCAGAGGTCTGG
CACATCGCCCAGACCGGCGAGGTTTTCATCACCTACGAAGACTATCTGAGTCGCATGGAGTTTTACAAACAGCGC
CGCTTCAACGACCAGATCACCGGTCACTCGGGCCTTACCTTTTTCGAGGCCTTTACCAGCGAGCTCGCCGGAGGC
CGTGAGGTCGACCTCAGCTTCCCAGAGGCTCTCAAAGGGCCCATTCTGCGCAAGGTCCAGTTTCAGACCATCTCC
CGCCTCGACAACCTCGTCGACATGATATATGACGAGTTCAAGCACGACTTCTACCCCGGCGAGGAGGTCACCGTC
ACCGTCGACGGCGGCGACCGAGTCCACGGCCTGGTTCGCGACAAGACTTCGTTTGGGCCCCGCATCCTACCCGAC
GGATCCCACGCGCAGCCCATGACCCGCTATCTCGTCAACATCAAGGACACCGAGGAGGAGACCATGGTCACCGAC
GAGCACATCTGCCGCGACCGTGGCACCTTCACAAAGTCGATGCTGAGGTCCTTCATCAAGAAGACTGTCATTCGG
GAGGCCTGGACCGGCGCCCCGTGGCTCGTCAAACACGACTACGCCGCCCAGCACCACATCGACACCCGAGTGCCC
CCCCAGCTCCGCTACGACACAAAGGTCCAGGAGCGCCGACAGCTCCAGGCCCAGAAGCGTGCCACCCCCCACGAC
GCCAACGCAAACGGCGCCACCACCGCAGCCGCCGCCATGAACCAGGGCCCCGTCCGCCTACCCGAGCTCAAGCCC
GCGCCAAAGAGCCACAAGGGCAAGCAGGGCTCCCAGGGCGCAAAGGGCCTCAAGTGGCCCCCTACCACGTCGCTC
AACGGCGCCAACGGCTACGGCCACCACCATCATCATCATCACCACCACCACCACCACCACTCCGCCGCCGACGGC
CACCGCGCAGCCGGCCTGCGAGATCCGCCCTCGCCGCCGTCCCCGCCACCTCCTCCGCCTCCAAAGTATCCGATC
GACGACCTCCTGCTCGAGCCCAAAAAAGGCAGCACGCGGCCCCGAATCAGCTTCATGTGCAGGGACCCTCCCGTC
GACGTCGAGGGCCGCGGGACCTTGCACGACCGCATCGACATGGCATCCGTCGGCGCCCTCCTCGAGACGTGGGAC
ACGCTCAACGTCTACTGCGAAATCTTCCGTCTCGACTCCTTCACGTTTGACGACTTTGTCGAGGCCATGTCGGTG
GCCTCGGACCGCGTCCACGTCCAGCTGTTCGAGGAGATACACTGCGCCGTCCTCAAGATCCTCGTCGAGTCCGAG
TCCGAAGGTGGCAGGGTCTGCATCGCCCTCCCCGACTTGGGCGACGACGCCGCCGATGGAGACACCGCCGTCGGG
CTACAGAGCCCCGATCCCACGCCCGAGCCGGAGCCGAAGCCGACGGGGCGCGCCACCCGCAGCAGCCTCGCAAAG
CTCGAGGCCGAGCGGCTGGCGGCCGAGGCGGCAGCGGCCGAGGAGGAGAGCATCCGGGCCGAGCTCGCGTCCAAG
CACCGGGCCGAGGAGCTCCTCAAGGAATACGACTGGATCGAGCACCTGCGCAAGCGCGACTTTGCCAACGGCGGC
TGGCAGAGGATCATCGTCGGTCTGCTGCACCAGCTGTCCAAGAAGGAGCGCCGGGAGAAGGCCTGCGAGGAGCTG
CTGCTACAACTGGTGCCGCCCAACACGATGCCGACGCAGGAGGCGGTGCGCCAGACGTACGCCAGGCTCGACATC
AACTACCGCGTCCGGGCGCTTCAGATCCTCTGCATGCTGACCATGGAGACCAAGGCCGTCAGGGCTTACATGGAG
GACTGCAGCGAGGCCATGACCAAGTATCGCAAGGACAGGATCGAGTGGCAGAGGCAGCGGAAGCAGGCGATTGAG
GATCTCAGGCAGCTCAACGAGGAGCGAAAGACGTTGATGCCCGACGTGACGCCCCCCGAATACCACCCCATCAAG
GAAGAAGACGTCAAGTTGGCAGACGACTCTCTCTTGGATCGGGAGGAAGACGGAGAAGGCGAAGCGGGCAAGTCG
CACAAAAAGCGCCGAAGCCGCGGTCCGACGGAGAAGCAGCGCAAGCGCGAAGAGGAGAGGGAACGAAAGACGCGA
GACAAGGAAAAGGGGCGGGACGGCGTCAAGGGTGCCAAGGGGACGACGAAGCTGCCGCCTCAGCAGCAGAAGCAG
TACAACAAGCTGCTCAAGGAGATACAGAAGCGCGAGGGCATCATCAAGGAATGCGAAGCCGAAATCGGCGTCATC
GAAAACGACCTTCGCGAGGCCGACTGCGCCAGGACGCGGGTCCTTGGCAAGGATCGCTTCTGGAACCGGTACTAC
TGGTTCGAACGCAACGGCATGCCCTACGGTGGACTCCCCAACAGCTCAACGGCATTTGCCGAGTACGCCAACGGC
TGCATCTGGGTGCAGGGCCCGGACGAGCTGGAGCGGACGGGCTACATCGACGTGCCGGCCGACGTCGACGACGAG
TACCGGGCGCGGTTCGACATGACGATAGCCGAACGCAAAGAGCGTGAGGAGGACGGGACGAGCGTCTTCAACGCG
ACGCAGTGGGGCTTCATCTGCGAGCCCGACGACGTGGACCGGCTGATACGCTGGCTGGACCCGCGCGGTCTCAAC
GAGCTGAAACTGCGCAAGGAGCTCCTCAACTACCGCGACAAGATGGCGACGCACATGGAGAGGCGTAAGAAGTAC
CTGTCGGAGGCCGAGACCGAGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCCGATACGGGCGACAAGGAGCGG
CGAGACGAGTCGACGAAGCGGACAAGCTCGCGGATCCGAGACAAGACGCCGGAGACGGCGCGGTACCGATGCCTG
CGATGGGAGAACACGATGGCGCTCGATGTACTGGGCCACCTGCACGCGGAGCAGCCACCGCCACCGCGACCGAAG
AAGCAGTCGAGGAAGAGGGAGGCGGCTGGCGAAGCGGCGGGACGAGGGCCGGCCAAGACGAGGCGGCGATAG
Gene >Ophcf2|06016
ATGGTAATCGCTGCAGTTTCCCCCCCCCCCCGCCCACCCGGACCGCGCTCACTCTTGCTTCTCTGCATATCTAGG
TCCTCTTCAAGCGGAAACCCGTCAAGTTTCTATCGCCTCCGGATATTGACGATGACGCCGCAGAGGTGACGTCTC
CTTTACCAAGCAACCCCCCGCCGCCGCGACGCGTCTTCTCACTCTTCCCCCACAGGTCTGGCACATCGCCCAGAC
CGGCGAGGTTTTCATCACCTACGAAGACTATCTGAGTCGGTTAGTCTTCCTGTTTACCCCTTTGATCCGCTACCC
TCGAGGCTGACGTCTCTGTCTAGCATGGAGTTTTACAAACAGGTAGCCCGTTCTTCCCGACGCCTTCCGGCCCGT
GACGCGACGTCTCTGACCCTCTTCCCCTCTCGAGCAGCGCCGCTTCAACGACCAGATCACCGGTCACTCGGGCCT
TACCTTTTTCGAGGCCTTTACCAGCGAGGTGGGTTCCCAGCCCCTTGGTTTCGTACACCGACCATCCTGTGCGAC
GCCGTGACGAGCCAGCTGCTCACACGCATATTTGACGTCCAGCTCGCCGGAGGCCGTGAGGTCGACCTCAGCTTC
CCAGAGGCTCTCAAAGGGCCCATTCTGCGCAAGGTCCAGTTTCAGACCATCTCCCGCCTCGACAACCTCGTCGAC
ATGATATATGACGAGTTCAAGCACGACTTCTACCCCGGCGAGGAGGTCACCGTCACCGTCGACGGCGGCGACCGA
GTCCACGGCCTGGTTCGCGACAAGACTTCGTTTGGGCCCCGCATCCTACCCGACGGATCCCACGCGCAGCCCATG
ACCCGCTATCTCGTCAACATCAAGGACACCGAGGAGGAGACCATGGTCACCGACGAGCACATCTGCCGCGACCGT
GGCACCTTCACAAAGTCGATGCTGAGGTCCTTCATCAAGAAGACTGTCATTCGGGAGGCCTGGACCGGCGCCCCG
TGGCTCGTCAAACACGACTACGCCGCCCAGCACCACATCGACACCCGAGTGCCCCCCCAGCTCCGCTACGACACA
AAGGTCCAGGAGCGCCGACAGCTCCAGGCCCAGAAGCGTGCCACCCCCCACGACGCCAACGCAAACGGCGCCACC
ACCGCAGCCGCCGCCATGAACCAGGGCCCCGTCCGCCTACCCGAGCTCAAGCCCGCGCCAAAGAGCCACAAGGGC
AAGCAGGGCTCCCAGGGCGCAAAGGGCCTCAAGTGGCCCCCTACCACGTCGCTCAACGGCGCCAACGGCTACGGC
CACCACCATCATCATCATCACCACCACCACCACCACCACTCCGCCGCCGACGGCCACCGCGCAGCCGGCCTGCGA
GATCCGCCCTCGCCGCCGTCCCCGCCACCTCCTCCGCCTCCAAAGTATCCGATCGACGACCTCCTGCTCGAGCCC
AAAAAAGGCAGCACGCGGCCCCGAATCAGCTTCATGTGCAGGGACCCTCCCGTCGACGTCGAGGGCCGCGGGACC
TTGCACGACCGCATCGACATGGCATCCGTCGGCGCCCTCCTCGAGACGTGGGACACGCTCAACGTCTACTGCGAA
ATCTTCCGTCTCGACTCCTTCACGTTTGACGACTTTGTCGAGGCCATGTCGGTGGCCTCGGACCGCGTCCACGTC
CAGCTGTTCGAGGAGATACACTGCGCCGTCCTCAAGATCCTCGTCGAGTCCGAGTCCGAAGGTGGCAGGGTCTGC
ATCGCCCTCCCCGACTTGGGCGACGACGCCGCCGATGGAGACACCGCCGTCGGGCTACAGAGCCCCGATCCCACG
CCCGAGCCGGAGCCGAAGCCGACGGGGCGCGCCACCCGCAGCAGCCTCGCAAAGCTCGAGGCCGAGCGGCTGGCG
GCCGAGGCGGCAGCGGCCGAGGAGGAGAGCATCCGGGCCGAGCTCGCGTCCAAGCACCGGGCCGAGGAGCTCCTC
AAGGAATACGACTGGATCGAGCACCTGCGCAAGCGCGACTTTGCCAACGGCGGCTGGCAGAGGATCATCGTCGGT
CTGCTGCACCAGCTGTCCAAGAAGGAGCGCCGGGAGAAGGCCTGCGAGGAGCTGCTGCTACAACTGGTGCCGCCC
AACACGATGCCGACGCAGGAGGCGGTGCGCCAGACGTACGCCAGGCTCGACATCAACTACCGCGTCCGGGCGCTT
CAGATCCTCTGCATGCTGACCATGGAGACCAAGGCCGTCAGGGCTTACATGGAGGACTGCAGCGAGGCCATGACC
AAGTATCGCAAGGACAGGATCGAGTGGCAGAGGCAGCGGAAGCAGGCGTGAGTTCTTGTGGCCCTGGAACCTGTC
CTCTTGTTTTTTTTTTCTCCCCCAGATGCTGATGTTTCTCAGGATTGAGGATCTCAGGCAGCTCAACGAGGAGCG
AAAGACGTTGATGCCCGACGTGACGCCCCCCGAATACCACCCCATCAAGGAAGAAGACGTCAAGTTGGCAGACGA
CTCTCTCTTGGATCGGGAGGAAGACGGAGAAGGCGAAGCGGGCAAGTCGCACAAAAAGCGCCGAAGCCGCGGTCC
GACGGAGAAGCAGCGCAAGCGCGAAGAGGAGAGGGAACGAAAGACGCGAGACAAGGAAAAGGGGCGGGACGGCGT
CAAGGGTGCCAAGGGGACGACGAAGCTGCCGCCTCAGCAGCAGAAGCAGTACAACAAGCTGCTCAAGGAGATACA
GAAGCGCGAGGGCATCATCAAGGAATGCGAAGCCGAAATCGGCGTCATCGAAAACGACCTTCGCGAGGCCGACTG
CGCCAGGACGCGGGTCCTTGGCAAGGATCGCTTCTGGAACCGGTACTACTGGTTCGAACGCAACGGCATGCCCTA
CGGTGGACTCCCCAACAGCTCAACGGCATTTGCCGAGTACGCCAACGGCTGCATCTGGGTGCAGGGCCCGGACGA
GCTGGAGCGGACGGGCTACATCGACGTGCCGGCCGACGTCGACGACGAGTACCGGGCGCGGTTCGACATGACGAT
AGCCGAACGCAAAGAGCGTGAGGAGGACGGGACGAGCGTCTTCAACGCGACGCAGTGGGGCTTCATCTGCGAGCC
CGACGACGTGGACCGGCTGATACGCTGGCTGGACCCGCGCGGTCTCAACGAGCTGAAACTGCGCAAGGAGCTCCT
CAACTACCGCGACAAGATGGCGACGCACATGGAGAGGCGTAAGAAGTACCTGTCGGAGGCCGAGACCGAGGTGGC
GGCGGCGGCGGCGGCGGCGGCGGCGGCCGATACGGGCGACAAGGAGCGGCGAGACGAGTCGACGAAGCGGACAAG
CTCGCGGATCCGAGACAAGACGCCGGAGACGGCGCGGTACCGATGCCTGCGATGGGAGAACACGATGGCGCTCGA
TGTACTGGGCCACCTGCACGCGGAGCAGCCACCGCCACCGCGACCGAAGAAGCAGTCGAGGAAGAGGGAGGCGGC
TGGCGAAGCGGCGGGACGAGGGCCGGCCAAGACGAGGCGGCGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail