Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06015
Gene name
Locationscaffold_07:403451..405099
Strand+
Gene length (bp)1648
Transcript length (bp)1515
Coding sequence length (bp)1515
Protein length (aa) 505

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03155 Alg6_Alg8 ALG6, ALG8 glycosyltransferase family 1.5E-168 15 495

GO

GO Term Description Terminal node
GO:0016758 hexosyltransferase activity Yes
GO:0016757 glycosyltransferase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 97 119 22
2 132 151 19
3 181 203 22
4 224 246 22
5 358 380 22
6 387 406 19
7 416 435 19
8 447 469 22
9 479 501 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06015
MTEPYPTITQCAVVATAFKILLFPAYKSTDFEVHRNWLAVTHSLPISEWYFDENSPWTLDYPPLFAYWEWLLAHV
ARLVDPHMVRLYSIGHETWPTVCFQRASVIFAELFLFFALHLFVDWCPLASRRAAQVAALSIFLSPGLLIIDHIH
FQYNGFLYGFLVLSLVLARRRPTLLHSAVVFAALLCFKHIYLYLAPAYFVFLLRTYCLSARSIWRPEFFNCFKLA
AAVSAVFAASLGPFALMGQLPQLLHRLFPFSRGLCHAYWAPNVWALYSLADRVMIHLAPRVGLSLKTQALQSVTR
GLVGDSSFAVLPDVTPRTCFILTLFFQAPPLIRMLVRQTRPTWEDLVSAVTLCGYASFLFGWHVHEKAILLVVIP
FSLVALRDRRHLSAFRPLAVAAHVSLFPLLFTPAEFPIKTAYTIFWLVLFLLAFDRLAPASDKPRFFLLDRFSTL
YIAGSVPLIAYASLLHRAIFGDALAFLPLVFISCYAAVGVIGSWAGFMVVHLTS*
Coding >Ophcf2|06015
ATGACAGAGCCATACCCTACAATAACGCAATGCGCCGTCGTCGCCACCGCCTTCAAAATCCTTCTCTTCCCCGCA
TACAAATCTACCGACTTCGAGGTTCATCGCAACTGGCTGGCCGTCACACACAGCTTGCCCATCTCCGAGTGGTAC
TTTGACGAGAATTCGCCGTGGACGCTGGATTATCCTCCGCTCTTTGCCTATTGGGAGTGGTTGCTTGCTCATGTT
GCTCGGCTTGTTGACCCGCACATGGTGCGGCTTTATAGCATTGGGCATGAGACGTGGCCGACTGTTTGCTTTCAG
CGGGCTTCTGTTATTTTTGCAGAGCTTTTTCTTTTCTTTGCGCTGCATCTCTTTGTTGACTGGTGTCCGCTTGCG
TCGCGGCGAGCTGCTCAGGTTGCGGCTCTGTCCATCTTTCTGTCACCGGGTTTGCTCATCATCGATCACATTCAC
TTTCAGTACAATGGTTTTCTCTACGGATTTCTCGTCCTTTCTCTCGTCCTCGCTCGTCGAAGGCCTACGCTGCTG
CACAGCGCCGTAGTCTTCGCCGCTCTGCTGTGCTTCAAGCACATCTACCTCTACCTCGCGCCGGCCTACTTTGTC
TTTTTGTTGCGCACCTACTGTCTCTCGGCTCGCTCCATATGGCGTCCCGAATTCTTCAACTGCTTCAAGCTCGCC
GCCGCCGTATCCGCCGTCTTCGCCGCCTCTCTGGGTCCATTTGCGCTCATGGGCCAGTTGCCGCAGCTGTTGCAT
CGCCTGTTTCCCTTTTCTCGCGGTCTCTGTCACGCATACTGGGCGCCCAACGTCTGGGCTCTTTACTCGCTGGCC
GATCGCGTCATGATTCATCTCGCGCCGCGTGTCGGCCTTTCGCTAAAAACGCAGGCGCTGCAGAGCGTCACTCGC
GGCCTCGTCGGCGACTCCTCCTTTGCCGTTCTCCCCGATGTGACGCCGCGGACGTGCTTCATCCTCACGCTCTTT
TTCCAGGCGCCGCCGCTTATACGGATGCTCGTGCGGCAGACGCGGCCGACGTGGGAGGACCTGGTGAGCGCCGTT
ACGCTGTGCGGATACGCCTCCTTCCTCTTCGGCTGGCACGTGCACGAAAAGGCCATCCTGCTGGTGGTGATACCC
TTCAGCCTGGTGGCCCTGCGAGACCGACGGCACCTCAGCGCGTTCCGACCGCTAGCCGTGGCGGCGCACGTGTCG
CTGTTCCCGCTGCTCTTCACGCCGGCCGAGTTCCCCATCAAGACGGCATACACCATATTCTGGCTGGTCCTGTTC
TTGCTGGCGTTCGATAGGCTCGCTCCGGCCTCGGACAAGCCGCGCTTCTTCTTGCTGGACCGCTTCAGCACGCTG
TACATTGCCGGCAGCGTGCCGCTGATCGCGTACGCATCGCTGCTGCATCGTGCCATCTTCGGCGACGCACTCGCG
TTTCTGCCCCTCGTGTTCATCAGCTGCTACGCTGCCGTGGGCGTCATCGGCAGCTGGGCCGGCTTCATGGTGGTG
CATCTGACGTCGTGA
Transcript >Ophcf2|06015
ATGACAGAGCCATACCCTACAATAACGCAATGCGCCGTCGTCGCCACCGCCTTCAAAATCCTTCTCTTCCCCGCA
TACAAATCTACCGACTTCGAGGTTCATCGCAACTGGCTGGCCGTCACACACAGCTTGCCCATCTCCGAGTGGTAC
TTTGACGAGAATTCGCCGTGGACGCTGGATTATCCTCCGCTCTTTGCCTATTGGGAGTGGTTGCTTGCTCATGTT
GCTCGGCTTGTTGACCCGCACATGGTGCGGCTTTATAGCATTGGGCATGAGACGTGGCCGACTGTTTGCTTTCAG
CGGGCTTCTGTTATTTTTGCAGAGCTTTTTCTTTTCTTTGCGCTGCATCTCTTTGTTGACTGGTGTCCGCTTGCG
TCGCGGCGAGCTGCTCAGGTTGCGGCTCTGTCCATCTTTCTGTCACCGGGTTTGCTCATCATCGATCACATTCAC
TTTCAGTACAATGGTTTTCTCTACGGATTTCTCGTCCTTTCTCTCGTCCTCGCTCGTCGAAGGCCTACGCTGCTG
CACAGCGCCGTAGTCTTCGCCGCTCTGCTGTGCTTCAAGCACATCTACCTCTACCTCGCGCCGGCCTACTTTGTC
TTTTTGTTGCGCACCTACTGTCTCTCGGCTCGCTCCATATGGCGTCCCGAATTCTTCAACTGCTTCAAGCTCGCC
GCCGCCGTATCCGCCGTCTTCGCCGCCTCTCTGGGTCCATTTGCGCTCATGGGCCAGTTGCCGCAGCTGTTGCAT
CGCCTGTTTCCCTTTTCTCGCGGTCTCTGTCACGCATACTGGGCGCCCAACGTCTGGGCTCTTTACTCGCTGGCC
GATCGCGTCATGATTCATCTCGCGCCGCGTGTCGGCCTTTCGCTAAAAACGCAGGCGCTGCAGAGCGTCACTCGC
GGCCTCGTCGGCGACTCCTCCTTTGCCGTTCTCCCCGATGTGACGCCGCGGACGTGCTTCATCCTCACGCTCTTT
TTCCAGGCGCCGCCGCTTATACGGATGCTCGTGCGGCAGACGCGGCCGACGTGGGAGGACCTGGTGAGCGCCGTT
ACGCTGTGCGGATACGCCTCCTTCCTCTTCGGCTGGCACGTGCACGAAAAGGCCATCCTGCTGGTGGTGATACCC
TTCAGCCTGGTGGCCCTGCGAGACCGACGGCACCTCAGCGCGTTCCGACCGCTAGCCGTGGCGGCGCACGTGTCG
CTGTTCCCGCTGCTCTTCACGCCGGCCGAGTTCCCCATCAAGACGGCATACACCATATTCTGGCTGGTCCTGTTC
TTGCTGGCGTTCGATAGGCTCGCTCCGGCCTCGGACAAGCCGCGCTTCTTCTTGCTGGACCGCTTCAGCACGCTG
TACATTGCCGGCAGCGTGCCGCTGATCGCGTACGCATCGCTGCTGCATCGTGCCATCTTCGGCGACGCACTCGCG
TTTCTGCCCCTCGTGTTCATCAGCTGCTACGCTGCCGTGGGCGTCATCGGCAGCTGGGCCGGCTTCATGGTGGTG
CATCTGACGTCGTGA
Gene >Ophcf2|06015
ATGACAGAGCCATACCCTACAATAACGCAATGCGCCGTCGTCGCCACCGCCTTCAAAATCCTTCTCTTCCCCGCA
TAGTCCGTCTGCCCCAATCTGACGAGACTCTGTCGCCTCAAGCTGACGTCAAGTCGTCGTGGCAGCAAATCTACC
GACTTCGAGGTTCATCGCAACTGGCTGGCCGTCACACACAGCTTGCCCATCTCCGAGTGGTACTTTGACGAGAAT
TCGCCGTGGACGCTGGATTATCCTCCGCTCTTTGCCTATTGGGAGTGGTTGCTTGCTCATGTTGCTCGGCTTGTT
GACCCGCACATGGTGCGGCTTTATAGCATTGGGCATGAGACGTGGCCGACTGTTTGCTTTCAGCGGGCTTCTGTT
ATTTTTGCAGAGCTTTTTCTTTTCTTTGCGCTGCATCTCTTTGTTGACTGGTGTCCGCTTGCGTCGCGGCGAGCT
GCTCAGGTTGCGGCTCTGTCCATCTTTCTGTCACCGGGTTTGCTCATCATCGATCACATTCACTTTCAGTACAAT
GGTTTTCTCTACGGATTTCTCGTCCTTTCTCTCGTCCTCGCTCGTCGAAGGCCTACGCTGCTGCACAGCGCCGTA
GTCTTCGCCGCTCTGCTGTGCTTCAAGCACATCTACCTCTACCTCGCGCCGGCCTACTTTGTCTTTTTGTTGCGC
ACCTACTGTCTCTCGGCTCGCTCCATATGGCGTCCCGAATTCTTCAACTGCTTCAAGCTCGCCGCCGCCGTATCC
GCCGTCTTCGCCGCCTCTCTGGGTCCATTTGCGCTCATGGGCCAGTTGCCGCAGCTGTTGCATCGCCTGTTTCCC
TTTTCTCGCGGTCTCTGTCACGCATACTGGGCGCCCAACGTCTGGGCTCTTTACTCGCTGGCCGATCGCGTCATG
ATTCATCGTCAGTAGCGGATGCGGCCGTTATATTCCCATTCTCTCCGCACGTCTTGCTGACTTGGCTCTACCCGC
AGTCGCGCCGCGTGTCGGCCTTTCGCTAAAAACGCAGGCGCTGCAGAGCGTCACTCGCGGCCTCGTCGGCGACTC
CTCCTTTGCCGTTCTCCCCGATGTGACGCCGCGGACGTGCTTCATCCTCACGCTCTTTTTCCAGGCGCCGCCGCT
TATACGGATGCTCGTGCGGCAGACGCGGCCGACGTGGGAGGACCTGGTGAGCGCCGTTACGCTGTGCGGATACGC
CTCCTTCCTCTTCGGCTGGCACGTGCACGAAAAGGCCATCCTGCTGGTGGTGATACCCTTCAGCCTGGTGGCCCT
GCGAGACCGACGGCACCTCAGCGCGTTCCGACCGCTAGCCGTGGCGGCGCACGTGTCGCTGTTCCCGCTGCTCTT
CACGCCGGCCGAGTTCCCCATCAAGACGGCATACACCATATTCTGGCTGGTCCTGTTCTTGCTGGCGTTCGATAG
GCTCGCTCCGGCCTCGGACAAGCCGCGCTTCTTCTTGCTGGACCGCTTCAGCACGCTGTACATTGCCGGCAGCGT
GCCGCTGATCGCGTACGCATCGCTGCTGCATCGTGCCATCTTCGGCGACGCACTCGCGTTTCTGCCCCTCGTGTT
CATCAGCTGCTACGCTGCCGTGGGCGTCATCGGCAGCTGGGCCGGCTTCATGGTGGTGCATCTGACGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail