Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06013
Gene name
Locationscaffold_07:399167..401183
Strand+
Gene length (bp)2016
Transcript length (bp)867
Coding sequence length (bp)867
Protein length (aa) 289

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05195 AMP_N Aminopeptidase P, N-terminal domain 7.6E-22 47 162
PF00557 Peptidase_M24 Metallopeptidase family M24 2.4E-15 205 284

GO

GO Term Description Terminal node
GO:0070006 metalloaminopeptidase activity Yes
GO:0030145 manganese ion binding Yes
GO:0043169 cation binding No
GO:0004177 aminopeptidase activity No
GO:0046914 transition metal ion binding No
GO:0008237 metallopeptidase activity No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0016787 hydrolase activity No
GO:0008235 metalloexopeptidase activity No
GO:0008238 exopeptidase activity No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion|Plastid 0.3756 0.1447 0.3527 0.0695 0.7113 0.7291 0.1809 0.2199 0.2733 0.3085

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup235
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4874
Ophiocordyceps australis 1348a (Ghana) OphauG2|5858
Ophiocordyceps australis map64 (Brazil) OphauB2|258
Ophiocordyceps australis map64 (Brazil) OphauB2|746
Ophiocordyceps camponoti-floridani Ophcf2|06013 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06945
Ophiocordyceps camponoti-rufipedis Ophun1|1590
Ophiocordyceps camponoti-rufipedis Ophun1|6825
Ophiocordyceps kimflemingae Ophio5|1016
Ophiocordyceps kimflemingae Ophio5|6975
Ophiocordyceps subramaniannii Hirsu2|4741
Ophiocordyceps subramaniannii Hirsu2|6360

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06013
MLFRLPLPAKVKDDAMRRPVLRHPESLVGGCSSVPVAKYPAKLHASRVVDELGVGDGLVYLEGQRERNLEDSDQS
VPFRQRRYFFYVAGADFPGCHVTYDVKAKRLTLWVPYVAPKDVLWFGSRPSPEECFARYDVDHVRYVDELAGYVD
DFQARNPSSTIYLLHADQKPPSRQPFHSTKQFQDSLLKPAMDRARVVKTDYEIAMIRHANDISSAAHRSIASRLH
TLRSERDVEAIFQEVCTLYGTRTQAYPIIAGAGANAATLHYDANDQSLVGRELLLLDAGRNAH*
Coding >Ophcf2|06013
ATGCTTTTCCGACTCCCCTTGCCGGCTAAGGTCAAGGACGACGCCATGAGACGACCCGTTCTCCGGCATCCCGAA
TCGTTGGTGGGGGGTTGCAGTTCCGTGCCGGTAGCGAAATATCCCGCTAAGCTTCATGCGAGTCGGGTGGTTGAT
GAGCTTGGGGTCGGTGATGGGCTCGTCTACCTCGAGGGTCAAAGGGAGAGGAACCTTGAGGATTCGGATCAGTCC
GTGCCTTTTCGCCAGCGTCGATACTTCTTCTATGTTGCGGGAGCGGACTTTCCTGGGTGTCATGTCACGTACGAC
GTCAAGGCCAAGCGGTTGACTCTCTGGGTTCCTTATGTTGCGCCCAAGGATGTGCTGTGGTTTGGTTCAAGGCCT
TCGCCGGAGGAGTGCTTTGCTCGGTACGATGTCGATCATGTGCGTTATGTCGATGAGCTGGCTGGCTATGTCGAT
GACTTCCAGGCTCGCAACCCGTCTTCAACCATCTACCTTTTACACGCGGACCAAAAGCCACCATCAAGGCAGCCA
TTCCACTCCACCAAACAATTCCAAGACTCACTGCTCAAGCCAGCCATGGACCGCGCCCGCGTAGTCAAAACAGAC
TACGAAATAGCCATGATCCGGCACGCAAACGACATCTCAAGCGCCGCACACCGAAGCATCGCCTCGCGACTCCAC
ACTCTCAGATCAGAACGCGACGTCGAAGCCATCTTCCAAGAGGTGTGCACCCTGTACGGAACCCGCACGCAAGCC
TACCCCATCATCGCGGGCGCGGGCGCCAACGCGGCGACGCTGCACTACGACGCGAATGACCAGTCGCTTGTTGGA
CGCGAGCTTCTCCTCCTGGACGCGGGACGCAATGCCCATTGA
Transcript >Ophcf2|06013
ATGCTTTTCCGACTCCCCTTGCCGGCTAAGGTCAAGGACGACGCCATGAGACGACCCGTTCTCCGGCATCCCGAA
TCGTTGGTGGGGGGTTGCAGTTCCGTGCCGGTAGCGAAATATCCCGCTAAGCTTCATGCGAGTCGGGTGGTTGAT
GAGCTTGGGGTCGGTGATGGGCTCGTCTACCTCGAGGGTCAAAGGGAGAGGAACCTTGAGGATTCGGATCAGTCC
GTGCCTTTTCGCCAGCGTCGATACTTCTTCTATGTTGCGGGAGCGGACTTTCCTGGGTGTCATGTCACGTACGAC
GTCAAGGCCAAGCGGTTGACTCTCTGGGTTCCTTATGTTGCGCCCAAGGATGTGCTGTGGTTTGGTTCAAGGCCT
TCGCCGGAGGAGTGCTTTGCTCGGTACGATGTCGATCATGTGCGTTATGTCGATGAGCTGGCTGGCTATGTCGAT
GACTTCCAGGCTCGCAACCCGTCTTCAACCATCTACCTTTTACACGCGGACCAAAAGCCACCATCAAGGCAGCCA
TTCCACTCCACCAAACAATTCCAAGACTCACTGCTCAAGCCAGCCATGGACCGCGCCCGCGTAGTCAAAACAGAC
TACGAAATAGCCATGATCCGGCACGCAAACGACATCTCAAGCGCCGCACACCGAAGCATCGCCTCGCGACTCCAC
ACTCTCAGATCAGAACGCGACGTCGAAGCCATCTTCCAAGAGGTGTGCACCCTGTACGGAACCCGCACGCAAGCC
TACCCCATCATCGCGGGCGCGGGCGCCAACGCGGCGACGCTGCACTACGACGCGAATGACCAGTCGCTTGTTGGA
CGCGAGCTTCTCCTCCTGGACGCGGGACGCAATGCCCATTGA
Gene >Ophcf2|06013
ATGCTTTTCCGACTCCCCTTGCCGGCTAAGGTCAAGGACGACGCCATGAGACGACCCGTTCTCCGGCATCCCGAA
TCGTTGTCCGTCTTTTCTTGGTTCCGCGAGGCTGAGCCTGCAGCGCTGATGTCGTCGACAGGGTGGGGGGTTGCA
GTTCCGTGCCGGTAGCGAAATATCCCGGTATGTCATGTCGTTGTTCATTTGCCGGTGGATGATGATGCGGGAAGT
TAAAGCTTTTCTCAGCTAAGCTTCATGCGAGTCGGGTGGTTGATGAGCTTGGGGTCGGTGATGGGCTCGTCTACC
TCGAGGGTCAAAGGGAGAGGAACCTTGAGGATTCGGATCAGTCCGTGCCTTTTCGCCAGCGTCGATAGTGAGTAT
CGTTTTGTTTTGGTTCTTTTAGGGGGGCGGGCATCTGCTTACCGTAATTACTTACAGCTTCTTCTATGTTGCGGG
AGCGGACTTTCCTGGGTGTCATGTCACGTACGACGTCAAGGCCAAGCGGTTGACTCTCTGGGTTCCTTATGTTGC
GCCCAAGGATGTGCTGTGGTTTGGTTCAAGGCCTTCGCCGGAGGAGTGCTTTGCTCGGTACGATGTCGATCATGT
GCGTTATGTCGATGAGCTGGCTGGCTATGTCGATGACTTCCAGGCTCGCAACCCGTCTTCAACCATCTACCTTTT
ACACGCGGACCAAAAGCCACCATCAAGGCAGCCATTCCACTCCACCAAACAATTCCAAGACTCACTGCTCAAGCC
AGCCATGGACCGCGCCCGCGTAGTCAAAACAGACTACGAAATAGCCATGATCCGGCACGCAAACGACATCTCAAG
CGCCGCACACCGAAGCATCGCCTCGCGACTCCACACTCTCAGATCAGAACGCGACGTCGAAGCCATCTTCCAAGA
GGTGTGCACCCTGTACGGAACCCGCACGCAAGCCTACCCCATCATCGCGGGCGCGGGCGCCAACGCGGCGACGCT
GCACTACGACGCGAATGACCAGTCGCTTGTTGGACGCGAGCTTCTCCTCCTGGACGCGGGGTGCGAATGGAAGGG
TTACGCGAGTGACGTGACGCGTACGATGCCGCTGACTGCATCGATTTCGCCTCGCGCGACGGCTGTGTATGCTAT
TGTCGAGGAGATGCAGGATGTTTGTTTTCGGAATGTCGGGCCGGGCGCTTGCTTTCGCCGTTTGCATTTGATGGC
TTCGTTGGTGGCGCTTGATGGGCTCATGGGCTTGGGGGTTTTGAAGGGGGAGAGGGAGGAGATTCTGAAGGCGGG
GACGGTGGCGGCGTTTTTCCCCCATGGTTTGGGGCATCATGTTGGCCTAGAGGTTCACGACGTTGATGGGGGGGA
GCCTCTCCTTGGGCCGTGCTCGGAGAATGCTTTCTCGGCGGTGGGAGGGAAGAGGGTGACCATTATGCCTGAGAC
GCTCGTCACCATGATGGCTGAACAGGAGGGATACGACGCCGGTGGAACAGGGAGGGAGAGAAAGGGGCTGCGGGA
GAACATGGTTGTTACGATCGAGCCGGGCATTTACTTTTGTCGGCCTTATCTCGAGGCGTCGTTTGTGGGGGATGG
CGTTCACGGCCGGTTTATCGATGAGGATGTGCTGGAGGGGTTTTATCCCGTTGGGGGGGTGAGGATCGAGGATGA
TGTACGGATTGTTGAGGGGGGAGGGGAGAATCTTACTTCTGTGCCGAGGGGGTTGGAGTTGTGGGACGGGTTGAG
ATGATGGTGGTTTGGAAGGCTTGTTGGTTTGGAGGAGTGTCGGGTTGCTTGTTAGTTGGGGTCGAGGTTTGCTTG
TCGTTGAGGATGGGCATGGGGTTTTTGACTCGTTGGTTTTTGTTGTATGCGTTGGGATTCTGAAGGTGAGTTGTT
GACGTTGACGTGACTTGACTCTTATCGTACGAATATAAGAGACGTGATGGGAGATATTCGACTTGCTTACTCTCA
GAGCCTTGCTTCATCGTACACACGCACAGCACAGACATACCGACATGCAGACGCAATGCCCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail