Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06007
Gene name
Locationscaffold_07:380692..387823
Strand-
Gene length (bp)7131
Transcript length (bp)7131
Coding sequence length (bp)7131
Protein length (aa) 2377

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08083 PROCN PROCN (NUC071) domain 2.6E-233 436 841
PF12134 PRP8_domainIV PRP8 domain IV core 1.2E-125 1802 2029
PF10596 U6-snRNA_bdg U6-snRNA interacting domain of PrP8 2.1E-88 1482 1640
PF08082 PRO8NT PRO8NT (NUC069), PrP8 N-terminal domain 8.7E-78 85 236
PF10597 U5_2-snRNA_bdg U5-snRNA binding site 2 of PrP8 1.1E-70 1250 1383
PF10598 RRM_4 RNA recognition motif of the spliceosomal PrP8 3.4E-45 1026 1116
PF08084 PROCT PROCT (NUC072) domain 1.0E-41 2253 2373

GO

GO Term Description Terminal node
GO:0017070 U6 snRNA binding Yes
GO:0003723 RNA binding Yes
GO:0030623 U5 snRNA binding Yes
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0017069 snRNA binding No
GO:0006397 mRNA processing No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0005488 binding No
GO:0016071 mRNA metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0008380 RNA splicing No
GO:0090304 nucleic acid metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4549 0.604 0.1067 0.1201 0.2215 0.2127 0.0946 0.0938 0.066 0.0206

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1550
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2806
Ophiocordyceps australis map64 (Brazil) OphauB2|739
Ophiocordyceps camponoti-floridani Ophcf2|06007 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1584
Ophiocordyceps kimflemingae Ophio5|1007
Ophiocordyceps subramaniannii Hirsu2|11273

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06007
MSSGPPPPPPGWEPPPPPPPPPSSSMPPPPSMPPPPSMPAPPPPGYQPHSDLQIAKFAQKKIKWLRNRRNRFGEK
RKAGFVQTQKADMPPEHLRKIVKDIGDVSQKKYTNDKRSYLGALKFMPHAVMKLLENMPMPWESAREVKVLYHVN
GCLTLVNEIPRVIEPVFFSQWAMMWTFMRKEKSDRRLFKRMRFPPFDDEEPPLSWSENIEDVEPLEPIQMELNED
EDEAVYEWFYDHRPLIDTPHVNGPSYKSWNLTLPQMATLFRLSRPLISDVVDKNYFYLFDLKSFLTAKALNVALP
GGPRFEPLYKDIDPNDEDFGEFNAIDRIIFRNPIRTEFRVAFPYLYNSLPRSVHLSWHSYPQVVFNRADDPDLPT
FHFDRRINPISSRTVAPKNVEVSHEDQLFGLGEDEEPDEEALELPVDMEPFLAEDELAGAETSAAIELWWAPYPF
NRRSGRTVRAQDVPLVKQWYLEHPPSDRPPVKVRVSYQKLLKNFVLNELHRKSPKAQNKQNLLRSLKQTKFFQQT
TIDWVEAGLQVCRQGFNMLNLLIHRKNLTYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRLTKLIVDA
QVQYRLGNIDAFQLADGILYAFNHVGQLTGMYRYKYKLMHQIRTCKDLKHLIYYRFNAGPVGKGPGCGFWAPAWR
VWLFFLRGIIPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHFDLELRASVMADLMDMMPEGIKQNKVNTVL
QHLSEAWRCWKSNIPWKVPGLPAPIENIILRYVKSKADWWISVAHYNRERIRRGATVDKTVAKKNVGRLTRLWLK
AEQERQHNHMKDGPYVSSEEAVAIYTTTVHWLESRKFSPIPFPSVSYKHDTKILILALERLREAYSVKGRLNQSQ
REELALIEQAYDSPGTTLERIKRFLLTQRAFKEVNIDMNDNYSTINPVYDIEPIEKISDAYLDQYLWYQADQRHL
FPAWIKPSDSEVPPLLVFKWAQGINNLGQVWETKDGECNVMIETELSKVYEKMELTLLNSLLRLIMDHNLADYIT
AKNNVQLTYKDMNHVNSYGMIRGLQFAAFVFQYYGLVLDLLLLGPQRASEIAGSPQSPNDFLQFRDRETECRHPI
RLYSRYIDKIWVFLRFTAEESRDLIQRFLTEQPDPNFENVIGYKSKKCWPRDSRMRLMRHDVNLGRAVFWDLKNR
LPRSVTTIDWDDSFVSVYSRDNPNLLFSMCGFEVRILPKIRNKNDEFPIKDSVWSLVDNTTKERTAYAFLQVTEQ
DIQKFNNRIRQILMSSGSTTFTKIANKWNTALIALFTYYREAAVSTINLLDTIVKCETKIQTRVKIGLNSKMPSR
FPPAVFYTPKELGGLGMISGSHILIPASDKRWSKQTDTGVTHYRAGMSHDEETLIPNIFRYIIPWEAEFIDSQRV
WTEYSQKRLEANQQNRRLTLEDLEDSWDRGLPRINTLFQKDRSTLSFDKGYRARSEFKVYQLMKSNPFWWTSQRH
DGKLWNLNAYRTDVIQALGGVETILEHTLFKATGFPSWEGLFWEKASGFEESMKFKKLTNAQRSGLNQIPNRRFT
LWWSPTINRANVYVGFQVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESVVMDLCQVFDQELESLGIETVQ
KETIHPRKSYKMNSSCADILLFASHKWNVTRPSQLHDTKDTIEPTTTNKFWIDVQLRYGDYDSHDIERYTRAKYL
DYTTDSASIYPSATGLMIGIDLAYNLYAAFGMYFPGLKVLVQQAMAKIMKANPALYVLRERIRKGLQLYASESNQ
EFLNSQNYSELFSNQIQLFIDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQ
LAKWKTAEEVAALIRSLPVEEQPRQLIVTRKGLLDPLEVQLVDFPNISIRASELQLPFQAAMKVEKLGDMILRAT
EPQMVLFNLYDEWLKTISSYTAFSRLILILRALHVNPDKTKMILRPDKTVITLDHHIWPSLTDEEWIKVETQLRD
LILNDYGKKNNVNVSSLTSSEVRDIILGMEISAPSMQRQQAAEIEKQQQEQQQLTAVTTKTQNVHGEDIIVTTTS
QFEQQTFASKTEWRTRAIATSNLRARTKNIYISSVDNDMEETTYVMPNNIIKRFITIADLRVQVAGYLYGSPPPD
NDQVMEIRCIVMVPQIGGLRNVQLPQQLPQSPLLEGLEPLGVIHTVSGNELSYMSAPDVTAHARLLDSHQTWDKS
NTVTVSVSFTPGSVSLSAWGLTPQGYQMGAENRDLQSDQPHGFTTTMGEKRKLLLSPRFRGFFLVPDDGRWNYSF
MGSAFAGMDKKPVPVKLDTPMPFYSDQHRPVHFQSFAEFEDIWVDRADNFE*
Coding >Ophcf2|06007
ATGTCTTCCGGTCCTCCTCCTCCGCCCCCGGGGTGGGAGCCTCCGCCTCCTCCTCCTCCTCCTCCATCGTCATCG
ATGCCACCTCCCCCTTCGATGCCTCCACCCCCCTCGATGCCGGCTCCTCCTCCCCCGGGCTACCAGCCTCACTCC
GATCTTCAGATCGCAAAGTTCGCTCAGAAGAAGATCAAATGGCTGCGAAATCGACGCAACAGGTTCGGAGAGAAG
CGCAAGGCTGGCTTTGTTCAGACGCAAAAGGCCGACATGCCCCCTGAGCACCTGCGCAAGATCGTCAAGGATATC
GGCGATGTCTCCCAGAAGAAATACACAAACGACAAGAGGAGCTACCTCGGTGCTCTTAAATTCATGCCGCATGCC
GTCATGAAGCTCTTGGAGAATATGCCGATGCCCTGGGAGTCTGCGCGGGAGGTCAAGGTTCTGTATCACGTCAAC
GGTTGCCTGACGCTAGTCAACGAGATTCCTCGCGTAATCGAGCCGGTCTTCTTTTCGCAGTGGGCGATGATGTGG
ACCTTTATGCGAAAGGAAAAATCCGATCGGAGATTGTTCAAGCGGATGCGCTTCCCCCCTTTCGACGATGAAGAA
CCACCGCTGTCGTGGTCTGAGAACATCGAGGATGTCGAGCCTCTGGAGCCCATCCAAATGGAGCTTAACGAAGAT
GAGGACGAGGCCGTCTATGAATGGTTCTACGACCACCGTCCGCTCATCGATACGCCGCACGTCAACGGCCCGAGC
TACAAGTCCTGGAACTTGACCTTGCCGCAGATGGCGACGCTGTTCCGTCTCAGCCGACCGCTCATCTCGGATGTT
GTGGACAAGAACTATTTCTATCTTTTTGACCTCAAAAGCTTCCTGACGGCCAAGGCGCTAAACGTCGCTCTTCCA
GGAGGCCCTCGATTCGAGCCTCTGTACAAGGACATTGATCCAAACGACGAGGACTTTGGCGAGTTCAACGCAATC
GACCGGATCATTTTCCGTAACCCCATTCGCACCGAGTTCCGAGTCGCCTTTCCGTACCTCTACAACTCGCTGCCG
CGAAGCGTCCATCTGTCCTGGCATTCGTATCCGCAGGTCGTCTTCAACCGGGCTGACGACCCTGACCTCCCGACG
TTCCACTTCGACCGGCGGATCAACCCCATCTCGTCGCGCACCGTCGCCCCGAAGAACGTTGAAGTGTCGCACGAA
GACCAACTCTTCGGTCTAGGAGAAGATGAAGAACCCGATGAGGAGGCGCTCGAATTGCCCGTCGATATGGAACCG
TTCTTGGCCGAGGACGAGCTTGCTGGCGCCGAGACTTCGGCGGCCATTGAACTTTGGTGGGCGCCTTACCCGTTT
AACAGGCGGTCTGGCAGAACGGTTCGCGCCCAGGACGTGCCGCTTGTGAAGCAGTGGTATCTTGAACACCCGCCC
TCCGACCGGCCGCCAGTTAAAGTTCGCGTCTCGTATCAGAAGCTGTTGAAGAACTTTGTCCTCAACGAACTTCAT
CGAAAGAGCCCGAAGGCGCAAAACAAGCAGAACCTCCTAAGGTCCTTGAAGCAGACCAAGTTCTTCCAGCAGACT
ACCATCGACTGGGTGGAAGCGGGCCTCCAGGTCTGCCGCCAGGGCTTCAACATGCTAAACCTGTTGATTCACCGC
AAGAACCTCACCTACCTGCATCTCGACTACAACTTCAACCTGAAACCCGTCAAGACGTTGACCACCAAGGAGCGG
AAGAAGTCGAGATTCGGCAACGCCTTTCACCTGATGAGAGAGATCCTGAGGCTGACCAAGCTGATTGTGGACGCT
CAGGTCCAGTATCGTCTGGGCAACATCGACGCCTTCCAACTTGCCGACGGTATTCTCTATGCTTTCAACCACGTC
GGACAGCTTACGGGCATGTATCGGTACAAGTACAAGCTGATGCACCAGATCCGGACCTGCAAGGACCTGAAGCAT
CTCATCTACTACCGTTTCAACGCTGGCCCTGTCGGCAAAGGCCCTGGCTGTGGTTTCTGGGCTCCGGCGTGGCGG
GTGTGGCTGTTTTTCCTGCGAGGCATCATTCCTCTCCTCGAGAGGTGGCTGGGGAACCTCCTGTCGCGTCAGTTC
GAGGGGCGTCATAGCAAGGGCGTGGCCAAAACGGTGACGAAGCAGCGGGTGGAGTCGCATTTCGACCTCGAACTC
CGGGCGTCTGTCATGGCCGATCTGATGGACATGATGCCGGAGGGCATCAAGCAGAACAAGGTGAATACGGTGCTC
CAGCACCTGTCTGAAGCCTGGCGATGCTGGAAGAGCAATATCCCGTGGAAGGTCCCTGGCTTGCCCGCCCCGATC
GAGAACATCATCCTGCGATACGTCAAGTCCAAGGCCGACTGGTGGATCTCGGTCGCTCATTACAACCGCGAAAGG
ATCCGGCGAGGAGCAACTGTGGACAAGACCGTCGCCAAGAAGAACGTCGGTCGCTTGACACGGCTGTGGCTCAAG
GCCGAGCAGGAGCGGCAACACAACCACATGAAGGACGGTCCGTACGTGTCATCCGAAGAGGCCGTTGCCATCTAT
ACCACCACGGTTCACTGGCTTGAGTCACGCAAATTCTCGCCCATCCCCTTCCCCAGCGTGTCGTATAAACATGAC
ACCAAGATTCTGATCCTGGCCCTCGAGCGCCTGAGAGAGGCTTACTCCGTCAAGGGTCGCCTCAATCAGAGCCAG
AGAGAAGAGCTGGCTCTGATAGAGCAAGCCTACGACAGCCCGGGCACCACGCTCGAGAGGATCAAGCGATTCCTG
CTCACGCAGCGGGCGTTCAAAGAAGTCAACATTGACATGAACGACAACTACAGCACCATCAACCCAGTCTACGAC
ATTGAGCCGATTGAGAAGATAAGCGACGCCTACCTGGATCAGTACCTCTGGTATCAGGCCGATCAGAGACACCTC
TTCCCCGCCTGGATCAAGCCGTCCGACTCCGAGGTGCCGCCGCTGCTGGTCTTCAAGTGGGCGCAGGGCATCAAC
AACCTAGGCCAGGTCTGGGAAACCAAGGACGGCGAATGCAACGTTATGATCGAAACAGAACTATCCAAGGTCTAC
GAAAAGATGGAGTTGACCCTACTCAACTCGCTGCTGAGACTCATCATGGACCACAACTTGGCCGATTACATCACC
GCCAAGAACAACGTGCAGCTCACGTACAAGGACATGAATCACGTCAACAGCTACGGCATGATCCGCGGCCTCCAG
TTCGCGGCCTTCGTGTTCCAGTATTACGGCCTGGTCCTGGATCTCTTACTGCTGGGACCGCAGCGAGCGAGCGAG
ATTGCCGGCTCGCCCCAGAGCCCCAACGACTTTCTGCAGTTCCGGGATAGGGAGACGGAGTGCAGGCATCCCATC
CGCTTGTACTCGCGCTACATCGACAAGATCTGGGTGTTTCTGCGCTTTACGGCCGAGGAGTCGAGAGATCTCATT
CAGCGCTTCCTCACCGAGCAGCCCGATCCCAACTTTGAGAATGTCATCGGATACAAGAGCAAGAAGTGTTGGCCG
CGCGACTCCCGCATGCGCCTGATGCGGCACGATGTGAATCTCGGCCGAGCCGTCTTCTGGGATCTGAAGAACCGG
CTGCCCCGATCCGTGACGACCATCGACTGGGACGACAGTTTCGTCAGCGTGTACAGCCGCGACAACCCTAACCTC
TTGTTCTCCATGTGCGGATTCGAAGTCAGGATCCTCCCCAAGATCAGAAACAAGAACGACGAGTTTCCCATCAAG
GACAGCGTGTGGTCGCTGGTTGACAACACGACCAAGGAGAGGACCGCGTATGCCTTTCTTCAGGTGACGGAACAA
GACATTCAAAAGTTCAATAACCGCATTCGACAGATCCTCATGTCGTCCGGCTCTACTACCTTTACCAAGATTGCC
AACAAGTGGAACACGGCCCTGATTGCGCTCTTTACCTACTATCGCGAGGCCGCCGTCTCCACCATCAATCTCTTG
GACACGATTGTCAAGTGCGAGACCAAGATTCAAACCCGAGTCAAGATAGGGCTCAACTCCAAGATGCCTTCGCGC
TTCCCTCCCGCCGTGTTCTACACGCCCAAGGAGCTGGGCGGCCTGGGCATGATCTCCGGCTCTCACATACTCATC
CCCGCCAGCGACAAGCGTTGGTCCAAGCAGACCGACACCGGCGTCACGCATTACCGAGCCGGCATGTCGCATGAC
GAGGAGACGCTCATCCCCAACATCTTCCGGTACATCATTCCTTGGGAAGCCGAGTTCATCGACTCGCAGCGAGTG
TGGACGGAATACTCGCAGAAGCGCCTCGAGGCGAACCAGCAGAATCGCCGGTTGACGCTCGAAGACCTCGAGGAT
AGTTGGGATCGAGGTCTGCCCAGAATCAACACGCTCTTCCAGAAGGATCGGAGCACTCTGAGCTTCGACAAGGGC
TACCGGGCTCGTTCGGAGTTCAAGGTGTACCAGCTCATGAAGAGTAACCCGTTCTGGTGGACGAGCCAGCGGCAC
GACGGAAAGCTGTGGAATCTCAACGCCTACCGGACCGACGTCATCCAGGCGCTGGGCGGAGTGGAAACGATCCTG
GAGCACACCCTTTTCAAGGCGACGGGGTTCCCCTCGTGGGAGGGTCTCTTCTGGGAGAAGGCTTCCGGGTTCGAG
GAATCGATGAAGTTCAAAAAGCTCACAAACGCCCAGAGGTCGGGCCTCAACCAGATTCCTAACCGTCGTTTCACT
CTCTGGTGGTCGCCCACCATCAACCGCGCCAACGTCTACGTCGGTTTCCAGGTGCAGCTCGATCTTACCGGCATC
TTCTTGCACGGAAAGATCCCGACGCTCAAGATCTCGCTCATCCAGATCTTCCGGGCGCATTTGTGGCAGAAGATT
CACGAGTCGGTCGTCATGGACCTGTGTCAAGTCTTTGACCAGGAGCTGGAGTCTTTGGGGATCGAAACGGTGCAG
AAGGAGACTATCCATCCGCGCAAGTCGTACAAGATGAACAGCTCCTGTGCCGATATCCTACTCTTTGCCAGCCAC
AAGTGGAACGTGACGCGGCCGTCGCAGCTTCACGATACCAAGGACACGATCGAGCCGACGACGACCAACAAGTTC
TGGATCGACGTTCAGCTGCGCTACGGAGACTACGACTCGCACGACATCGAGCGGTACACGCGCGCCAAATATCTC
GACTATACGACCGACAGCGCCAGCATCTATCCGTCGGCCACGGGGCTCATGATCGGCATCGATCTCGCGTATAAC
CTGTACGCTGCGTTCGGCATGTACTTTCCCGGGCTCAAGGTGCTGGTCCAGCAAGCCATGGCGAAGATTATGAAG
GCGAATCCCGCGCTATACGTGCTGCGCGAGCGCATTCGCAAGGGCTTGCAGTTGTACGCGTCGGAGAGCAACCAG
GAGTTCCTCAACTCGCAGAACTACTCGGAGTTATTCAGCAACCAGATTCAGCTGTTCATCGACGACACCAATGTC
TACCGCGTCACCATCCACAAGACATTCGAGGGCAACTTGACGACCAAGCCCATCAACGGAGCCATCTTCATCTTC
AACCCCAGGACCGGACAGCTCTTCCTCAAGATCATCCACACGAGCGTCTGGGCGGGACAGAAGCGTCTCGGACAG
CTGGCCAAGTGGAAGACGGCGGAAGAGGTGGCGGCTCTGATCAGGTCTCTGCCGGTGGAGGAGCAGCCTAGACAG
CTCATCGTCACGCGCAAGGGCCTGTTGGACCCCCTGGAGGTGCAGCTGGTCGACTTCCCCAACATCTCGATCCGG
GCGTCGGAACTGCAGCTCCCGTTCCAGGCGGCGATGAAGGTGGAGAAGCTGGGAGACATGATCCTGCGGGCGACG
GAGCCTCAGATGGTGCTGTTCAACCTGTACGACGAATGGCTGAAGACCATCTCGTCCTACACGGCCTTTTCCCGG
CTGATTCTCATTCTGCGCGCTCTCCACGTCAACCCAGACAAGACCAAGATGATTCTGCGGCCGGACAAGACGGTC
ATTACTCTGGATCACCACATCTGGCCGTCGCTGACGGACGAGGAATGGATCAAGGTGGAAACGCAGCTGCGAGAC
CTGATACTCAACGACTACGGCAAGAAGAACAACGTCAACGTATCGAGCCTGACGAGCAGCGAAGTGCGCGACATC
ATCTTGGGCATGGAGATATCGGCGCCTTCGATGCAGAGGCAGCAGGCGGCAGAGATTGAGAAGCAGCAGCAGGAA
CAGCAGCAGCTGACTGCGGTGACGACCAAGACGCAGAACGTGCACGGCGAAGACATAATCGTGACGACGACGTCG
CAGTTTGAGCAGCAGACGTTTGCGTCCAAGACGGAGTGGCGGACGAGGGCCATTGCCACGTCGAATCTACGGGCG
AGGACCAAGAACATCTACATATCGTCGGTGGACAACGACATGGAGGAGACGACGTACGTGATGCCCAACAACATC
ATCAAGCGCTTCATCACCATTGCCGATCTGCGCGTGCAGGTGGCCGGTTATCTGTACGGATCCCCGCCGCCGGAC
AACGATCAGGTGATGGAGATTCGGTGCATCGTCATGGTACCGCAGATCGGCGGCCTCCGCAACGTCCAGTTGCCG
CAGCAGCTGCCGCAGAGCCCGCTGCTGGAAGGGCTCGAGCCGCTGGGTGTCATCCACACCGTCTCGGGCAACGAG
CTGTCTTACATGTCGGCGCCGGACGTGACGGCACACGCGCGGCTGCTGGACTCGCACCAGACGTGGGACAAGTCG
AACACGGTGACCGTATCCGTCTCCTTCACGCCAGGCAGCGTCTCGCTCTCGGCATGGGGCCTCACGCCTCAGGGG
TACCAAATGGGGGCGGAAAACAGGGACCTGCAGAGCGACCAGCCTCACGGATTCACGACGACCATGGGGGAGAAG
CGCAAGCTGTTGCTGAGCCCTCGATTCCGGGGCTTCTTCCTGGTGCCGGACGACGGCAGATGGAACTACAGTTTC
ATGGGGAGCGCCTTCGCCGGCATGGACAAGAAGCCGGTTCCCGTCAAGCTGGATACGCCGATGCCCTTTTACAGT
GACCAGCATCGGCCGGTACACTTCCAGAGCTTTGCCGAGTTCGAGGACATTTGGGTCGATCGGGCCGATAACTTT
GAGTAA
Transcript >Ophcf2|06007
ATGTCTTCCGGTCCTCCTCCTCCGCCCCCGGGGTGGGAGCCTCCGCCTCCTCCTCCTCCTCCTCCATCGTCATCG
ATGCCACCTCCCCCTTCGATGCCTCCACCCCCCTCGATGCCGGCTCCTCCTCCCCCGGGCTACCAGCCTCACTCC
GATCTTCAGATCGCAAAGTTCGCTCAGAAGAAGATCAAATGGCTGCGAAATCGACGCAACAGGTTCGGAGAGAAG
CGCAAGGCTGGCTTTGTTCAGACGCAAAAGGCCGACATGCCCCCTGAGCACCTGCGCAAGATCGTCAAGGATATC
GGCGATGTCTCCCAGAAGAAATACACAAACGACAAGAGGAGCTACCTCGGTGCTCTTAAATTCATGCCGCATGCC
GTCATGAAGCTCTTGGAGAATATGCCGATGCCCTGGGAGTCTGCGCGGGAGGTCAAGGTTCTGTATCACGTCAAC
GGTTGCCTGACGCTAGTCAACGAGATTCCTCGCGTAATCGAGCCGGTCTTCTTTTCGCAGTGGGCGATGATGTGG
ACCTTTATGCGAAAGGAAAAATCCGATCGGAGATTGTTCAAGCGGATGCGCTTCCCCCCTTTCGACGATGAAGAA
CCACCGCTGTCGTGGTCTGAGAACATCGAGGATGTCGAGCCTCTGGAGCCCATCCAAATGGAGCTTAACGAAGAT
GAGGACGAGGCCGTCTATGAATGGTTCTACGACCACCGTCCGCTCATCGATACGCCGCACGTCAACGGCCCGAGC
TACAAGTCCTGGAACTTGACCTTGCCGCAGATGGCGACGCTGTTCCGTCTCAGCCGACCGCTCATCTCGGATGTT
GTGGACAAGAACTATTTCTATCTTTTTGACCTCAAAAGCTTCCTGACGGCCAAGGCGCTAAACGTCGCTCTTCCA
GGAGGCCCTCGATTCGAGCCTCTGTACAAGGACATTGATCCAAACGACGAGGACTTTGGCGAGTTCAACGCAATC
GACCGGATCATTTTCCGTAACCCCATTCGCACCGAGTTCCGAGTCGCCTTTCCGTACCTCTACAACTCGCTGCCG
CGAAGCGTCCATCTGTCCTGGCATTCGTATCCGCAGGTCGTCTTCAACCGGGCTGACGACCCTGACCTCCCGACG
TTCCACTTCGACCGGCGGATCAACCCCATCTCGTCGCGCACCGTCGCCCCGAAGAACGTTGAAGTGTCGCACGAA
GACCAACTCTTCGGTCTAGGAGAAGATGAAGAACCCGATGAGGAGGCGCTCGAATTGCCCGTCGATATGGAACCG
TTCTTGGCCGAGGACGAGCTTGCTGGCGCCGAGACTTCGGCGGCCATTGAACTTTGGTGGGCGCCTTACCCGTTT
AACAGGCGGTCTGGCAGAACGGTTCGCGCCCAGGACGTGCCGCTTGTGAAGCAGTGGTATCTTGAACACCCGCCC
TCCGACCGGCCGCCAGTTAAAGTTCGCGTCTCGTATCAGAAGCTGTTGAAGAACTTTGTCCTCAACGAACTTCAT
CGAAAGAGCCCGAAGGCGCAAAACAAGCAGAACCTCCTAAGGTCCTTGAAGCAGACCAAGTTCTTCCAGCAGACT
ACCATCGACTGGGTGGAAGCGGGCCTCCAGGTCTGCCGCCAGGGCTTCAACATGCTAAACCTGTTGATTCACCGC
AAGAACCTCACCTACCTGCATCTCGACTACAACTTCAACCTGAAACCCGTCAAGACGTTGACCACCAAGGAGCGG
AAGAAGTCGAGATTCGGCAACGCCTTTCACCTGATGAGAGAGATCCTGAGGCTGACCAAGCTGATTGTGGACGCT
CAGGTCCAGTATCGTCTGGGCAACATCGACGCCTTCCAACTTGCCGACGGTATTCTCTATGCTTTCAACCACGTC
GGACAGCTTACGGGCATGTATCGGTACAAGTACAAGCTGATGCACCAGATCCGGACCTGCAAGGACCTGAAGCAT
CTCATCTACTACCGTTTCAACGCTGGCCCTGTCGGCAAAGGCCCTGGCTGTGGTTTCTGGGCTCCGGCGTGGCGG
GTGTGGCTGTTTTTCCTGCGAGGCATCATTCCTCTCCTCGAGAGGTGGCTGGGGAACCTCCTGTCGCGTCAGTTC
GAGGGGCGTCATAGCAAGGGCGTGGCCAAAACGGTGACGAAGCAGCGGGTGGAGTCGCATTTCGACCTCGAACTC
CGGGCGTCTGTCATGGCCGATCTGATGGACATGATGCCGGAGGGCATCAAGCAGAACAAGGTGAATACGGTGCTC
CAGCACCTGTCTGAAGCCTGGCGATGCTGGAAGAGCAATATCCCGTGGAAGGTCCCTGGCTTGCCCGCCCCGATC
GAGAACATCATCCTGCGATACGTCAAGTCCAAGGCCGACTGGTGGATCTCGGTCGCTCATTACAACCGCGAAAGG
ATCCGGCGAGGAGCAACTGTGGACAAGACCGTCGCCAAGAAGAACGTCGGTCGCTTGACACGGCTGTGGCTCAAG
GCCGAGCAGGAGCGGCAACACAACCACATGAAGGACGGTCCGTACGTGTCATCCGAAGAGGCCGTTGCCATCTAT
ACCACCACGGTTCACTGGCTTGAGTCACGCAAATTCTCGCCCATCCCCTTCCCCAGCGTGTCGTATAAACATGAC
ACCAAGATTCTGATCCTGGCCCTCGAGCGCCTGAGAGAGGCTTACTCCGTCAAGGGTCGCCTCAATCAGAGCCAG
AGAGAAGAGCTGGCTCTGATAGAGCAAGCCTACGACAGCCCGGGCACCACGCTCGAGAGGATCAAGCGATTCCTG
CTCACGCAGCGGGCGTTCAAAGAAGTCAACATTGACATGAACGACAACTACAGCACCATCAACCCAGTCTACGAC
ATTGAGCCGATTGAGAAGATAAGCGACGCCTACCTGGATCAGTACCTCTGGTATCAGGCCGATCAGAGACACCTC
TTCCCCGCCTGGATCAAGCCGTCCGACTCCGAGGTGCCGCCGCTGCTGGTCTTCAAGTGGGCGCAGGGCATCAAC
AACCTAGGCCAGGTCTGGGAAACCAAGGACGGCGAATGCAACGTTATGATCGAAACAGAACTATCCAAGGTCTAC
GAAAAGATGGAGTTGACCCTACTCAACTCGCTGCTGAGACTCATCATGGACCACAACTTGGCCGATTACATCACC
GCCAAGAACAACGTGCAGCTCACGTACAAGGACATGAATCACGTCAACAGCTACGGCATGATCCGCGGCCTCCAG
TTCGCGGCCTTCGTGTTCCAGTATTACGGCCTGGTCCTGGATCTCTTACTGCTGGGACCGCAGCGAGCGAGCGAG
ATTGCCGGCTCGCCCCAGAGCCCCAACGACTTTCTGCAGTTCCGGGATAGGGAGACGGAGTGCAGGCATCCCATC
CGCTTGTACTCGCGCTACATCGACAAGATCTGGGTGTTTCTGCGCTTTACGGCCGAGGAGTCGAGAGATCTCATT
CAGCGCTTCCTCACCGAGCAGCCCGATCCCAACTTTGAGAATGTCATCGGATACAAGAGCAAGAAGTGTTGGCCG
CGCGACTCCCGCATGCGCCTGATGCGGCACGATGTGAATCTCGGCCGAGCCGTCTTCTGGGATCTGAAGAACCGG
CTGCCCCGATCCGTGACGACCATCGACTGGGACGACAGTTTCGTCAGCGTGTACAGCCGCGACAACCCTAACCTC
TTGTTCTCCATGTGCGGATTCGAAGTCAGGATCCTCCCCAAGATCAGAAACAAGAACGACGAGTTTCCCATCAAG
GACAGCGTGTGGTCGCTGGTTGACAACACGACCAAGGAGAGGACCGCGTATGCCTTTCTTCAGGTGACGGAACAA
GACATTCAAAAGTTCAATAACCGCATTCGACAGATCCTCATGTCGTCCGGCTCTACTACCTTTACCAAGATTGCC
AACAAGTGGAACACGGCCCTGATTGCGCTCTTTACCTACTATCGCGAGGCCGCCGTCTCCACCATCAATCTCTTG
GACACGATTGTCAAGTGCGAGACCAAGATTCAAACCCGAGTCAAGATAGGGCTCAACTCCAAGATGCCTTCGCGC
TTCCCTCCCGCCGTGTTCTACACGCCCAAGGAGCTGGGCGGCCTGGGCATGATCTCCGGCTCTCACATACTCATC
CCCGCCAGCGACAAGCGTTGGTCCAAGCAGACCGACACCGGCGTCACGCATTACCGAGCCGGCATGTCGCATGAC
GAGGAGACGCTCATCCCCAACATCTTCCGGTACATCATTCCTTGGGAAGCCGAGTTCATCGACTCGCAGCGAGTG
TGGACGGAATACTCGCAGAAGCGCCTCGAGGCGAACCAGCAGAATCGCCGGTTGACGCTCGAAGACCTCGAGGAT
AGTTGGGATCGAGGTCTGCCCAGAATCAACACGCTCTTCCAGAAGGATCGGAGCACTCTGAGCTTCGACAAGGGC
TACCGGGCTCGTTCGGAGTTCAAGGTGTACCAGCTCATGAAGAGTAACCCGTTCTGGTGGACGAGCCAGCGGCAC
GACGGAAAGCTGTGGAATCTCAACGCCTACCGGACCGACGTCATCCAGGCGCTGGGCGGAGTGGAAACGATCCTG
GAGCACACCCTTTTCAAGGCGACGGGGTTCCCCTCGTGGGAGGGTCTCTTCTGGGAGAAGGCTTCCGGGTTCGAG
GAATCGATGAAGTTCAAAAAGCTCACAAACGCCCAGAGGTCGGGCCTCAACCAGATTCCTAACCGTCGTTTCACT
CTCTGGTGGTCGCCCACCATCAACCGCGCCAACGTCTACGTCGGTTTCCAGGTGCAGCTCGATCTTACCGGCATC
TTCTTGCACGGAAAGATCCCGACGCTCAAGATCTCGCTCATCCAGATCTTCCGGGCGCATTTGTGGCAGAAGATT
CACGAGTCGGTCGTCATGGACCTGTGTCAAGTCTTTGACCAGGAGCTGGAGTCTTTGGGGATCGAAACGGTGCAG
AAGGAGACTATCCATCCGCGCAAGTCGTACAAGATGAACAGCTCCTGTGCCGATATCCTACTCTTTGCCAGCCAC
AAGTGGAACGTGACGCGGCCGTCGCAGCTTCACGATACCAAGGACACGATCGAGCCGACGACGACCAACAAGTTC
TGGATCGACGTTCAGCTGCGCTACGGAGACTACGACTCGCACGACATCGAGCGGTACACGCGCGCCAAATATCTC
GACTATACGACCGACAGCGCCAGCATCTATCCGTCGGCCACGGGGCTCATGATCGGCATCGATCTCGCGTATAAC
CTGTACGCTGCGTTCGGCATGTACTTTCCCGGGCTCAAGGTGCTGGTCCAGCAAGCCATGGCGAAGATTATGAAG
GCGAATCCCGCGCTATACGTGCTGCGCGAGCGCATTCGCAAGGGCTTGCAGTTGTACGCGTCGGAGAGCAACCAG
GAGTTCCTCAACTCGCAGAACTACTCGGAGTTATTCAGCAACCAGATTCAGCTGTTCATCGACGACACCAATGTC
TACCGCGTCACCATCCACAAGACATTCGAGGGCAACTTGACGACCAAGCCCATCAACGGAGCCATCTTCATCTTC
AACCCCAGGACCGGACAGCTCTTCCTCAAGATCATCCACACGAGCGTCTGGGCGGGACAGAAGCGTCTCGGACAG
CTGGCCAAGTGGAAGACGGCGGAAGAGGTGGCGGCTCTGATCAGGTCTCTGCCGGTGGAGGAGCAGCCTAGACAG
CTCATCGTCACGCGCAAGGGCCTGTTGGACCCCCTGGAGGTGCAGCTGGTCGACTTCCCCAACATCTCGATCCGG
GCGTCGGAACTGCAGCTCCCGTTCCAGGCGGCGATGAAGGTGGAGAAGCTGGGAGACATGATCCTGCGGGCGACG
GAGCCTCAGATGGTGCTGTTCAACCTGTACGACGAATGGCTGAAGACCATCTCGTCCTACACGGCCTTTTCCCGG
CTGATTCTCATTCTGCGCGCTCTCCACGTCAACCCAGACAAGACCAAGATGATTCTGCGGCCGGACAAGACGGTC
ATTACTCTGGATCACCACATCTGGCCGTCGCTGACGGACGAGGAATGGATCAAGGTGGAAACGCAGCTGCGAGAC
CTGATACTCAACGACTACGGCAAGAAGAACAACGTCAACGTATCGAGCCTGACGAGCAGCGAAGTGCGCGACATC
ATCTTGGGCATGGAGATATCGGCGCCTTCGATGCAGAGGCAGCAGGCGGCAGAGATTGAGAAGCAGCAGCAGGAA
CAGCAGCAGCTGACTGCGGTGACGACCAAGACGCAGAACGTGCACGGCGAAGACATAATCGTGACGACGACGTCG
CAGTTTGAGCAGCAGACGTTTGCGTCCAAGACGGAGTGGCGGACGAGGGCCATTGCCACGTCGAATCTACGGGCG
AGGACCAAGAACATCTACATATCGTCGGTGGACAACGACATGGAGGAGACGACGTACGTGATGCCCAACAACATC
ATCAAGCGCTTCATCACCATTGCCGATCTGCGCGTGCAGGTGGCCGGTTATCTGTACGGATCCCCGCCGCCGGAC
AACGATCAGGTGATGGAGATTCGGTGCATCGTCATGGTACCGCAGATCGGCGGCCTCCGCAACGTCCAGTTGCCG
CAGCAGCTGCCGCAGAGCCCGCTGCTGGAAGGGCTCGAGCCGCTGGGTGTCATCCACACCGTCTCGGGCAACGAG
CTGTCTTACATGTCGGCGCCGGACGTGACGGCACACGCGCGGCTGCTGGACTCGCACCAGACGTGGGACAAGTCG
AACACGGTGACCGTATCCGTCTCCTTCACGCCAGGCAGCGTCTCGCTCTCGGCATGGGGCCTCACGCCTCAGGGG
TACCAAATGGGGGCGGAAAACAGGGACCTGCAGAGCGACCAGCCTCACGGATTCACGACGACCATGGGGGAGAAG
CGCAAGCTGTTGCTGAGCCCTCGATTCCGGGGCTTCTTCCTGGTGCCGGACGACGGCAGATGGAACTACAGTTTC
ATGGGGAGCGCCTTCGCCGGCATGGACAAGAAGCCGGTTCCCGTCAAGCTGGATACGCCGATGCCCTTTTACAGT
GACCAGCATCGGCCGGTACACTTCCAGAGCTTTGCCGAGTTCGAGGACATTTGGGTCGATCGGGCCGATAACTTT
GAGTAA
Gene >Ophcf2|06007
ATGTCTTCCGGTCCTCCTCCTCCGCCCCCGGGGTGGGAGCCTCCGCCTCCTCCTCCTCCTCCTCCATCGTCATCG
ATGCCACCTCCCCCTTCGATGCCTCCACCCCCCTCGATGCCGGCTCCTCCTCCCCCGGGCTACCAGCCTCACTCC
GATCTTCAGATCGCAAAGTTCGCTCAGAAGAAGATCAAATGGCTGCGAAATCGACGCAACAGGTTCGGAGAGAAG
CGCAAGGCTGGCTTTGTTCAGACGCAAAAGGCCGACATGCCCCCTGAGCACCTGCGCAAGATCGTCAAGGATATC
GGCGATGTCTCCCAGAAGAAATACACAAACGACAAGAGGAGCTACCTCGGTGCTCTTAAATTCATGCCGCATGCC
GTCATGAAGCTCTTGGAGAATATGCCGATGCCCTGGGAGTCTGCGCGGGAGGTCAAGGTTCTGTATCACGTCAAC
GGTTGCCTGACGCTAGTCAACGAGATTCCTCGCGTAATCGAGCCGGTCTTCTTTTCGCAGTGGGCGATGATGTGG
ACCTTTATGCGAAAGGAAAAATCCGATCGGAGATTGTTCAAGCGGATGCGCTTCCCCCCTTTCGACGATGAAGAA
CCACCGCTGTCGTGGTCTGAGAACATCGAGGATGTCGAGCCTCTGGAGCCCATCCAAATGGAGCTTAACGAAGAT
GAGGACGAGGCCGTCTATGAATGGTTCTACGACCACCGTCCGCTCATCGATACGCCGCACGTCAACGGCCCGAGC
TACAAGTCCTGGAACTTGACCTTGCCGCAGATGGCGACGCTGTTCCGTCTCAGCCGACCGCTCATCTCGGATGTT
GTGGACAAGAACTATTTCTATCTTTTTGACCTCAAAAGCTTCCTGACGGCCAAGGCGCTAAACGTCGCTCTTCCA
GGAGGCCCTCGATTCGAGCCTCTGTACAAGGACATTGATCCAAACGACGAGGACTTTGGCGAGTTCAACGCAATC
GACCGGATCATTTTCCGTAACCCCATTCGCACCGAGTTCCGAGTCGCCTTTCCGTACCTCTACAACTCGCTGCCG
CGAAGCGTCCATCTGTCCTGGCATTCGTATCCGCAGGTCGTCTTCAACCGGGCTGACGACCCTGACCTCCCGACG
TTCCACTTCGACCGGCGGATCAACCCCATCTCGTCGCGCACCGTCGCCCCGAAGAACGTTGAAGTGTCGCACGAA
GACCAACTCTTCGGTCTAGGAGAAGATGAAGAACCCGATGAGGAGGCGCTCGAATTGCCCGTCGATATGGAACCG
TTCTTGGCCGAGGACGAGCTTGCTGGCGCCGAGACTTCGGCGGCCATTGAACTTTGGTGGGCGCCTTACCCGTTT
AACAGGCGGTCTGGCAGAACGGTTCGCGCCCAGGACGTGCCGCTTGTGAAGCAGTGGTATCTTGAACACCCGCCC
TCCGACCGGCCGCCAGTTAAAGTTCGCGTCTCGTATCAGAAGCTGTTGAAGAACTTTGTCCTCAACGAACTTCAT
CGAAAGAGCCCGAAGGCGCAAAACAAGCAGAACCTCCTAAGGTCCTTGAAGCAGACCAAGTTCTTCCAGCAGACT
ACCATCGACTGGGTGGAAGCGGGCCTCCAGGTCTGCCGCCAGGGCTTCAACATGCTAAACCTGTTGATTCACCGC
AAGAACCTCACCTACCTGCATCTCGACTACAACTTCAACCTGAAACCCGTCAAGACGTTGACCACCAAGGAGCGG
AAGAAGTCGAGATTCGGCAACGCCTTTCACCTGATGAGAGAGATCCTGAGGCTGACCAAGCTGATTGTGGACGCT
CAGGTCCAGTATCGTCTGGGCAACATCGACGCCTTCCAACTTGCCGACGGTATTCTCTATGCTTTCAACCACGTC
GGACAGCTTACGGGCATGTATCGGTACAAGTACAAGCTGATGCACCAGATCCGGACCTGCAAGGACCTGAAGCAT
CTCATCTACTACCGTTTCAACGCTGGCCCTGTCGGCAAAGGCCCTGGCTGTGGTTTCTGGGCTCCGGCGTGGCGG
GTGTGGCTGTTTTTCCTGCGAGGCATCATTCCTCTCCTCGAGAGGTGGCTGGGGAACCTCCTGTCGCGTCAGTTC
GAGGGGCGTCATAGCAAGGGCGTGGCCAAAACGGTGACGAAGCAGCGGGTGGAGTCGCATTTCGACCTCGAACTC
CGGGCGTCTGTCATGGCCGATCTGATGGACATGATGCCGGAGGGCATCAAGCAGAACAAGGTGAATACGGTGCTC
CAGCACCTGTCTGAAGCCTGGCGATGCTGGAAGAGCAATATCCCGTGGAAGGTCCCTGGCTTGCCCGCCCCGATC
GAGAACATCATCCTGCGATACGTCAAGTCCAAGGCCGACTGGTGGATCTCGGTCGCTCATTACAACCGCGAAAGG
ATCCGGCGAGGAGCAACTGTGGACAAGACCGTCGCCAAGAAGAACGTCGGTCGCTTGACACGGCTGTGGCTCAAG
GCCGAGCAGGAGCGGCAACACAACCACATGAAGGACGGTCCGTACGTGTCATCCGAAGAGGCCGTTGCCATCTAT
ACCACCACGGTTCACTGGCTTGAGTCACGCAAATTCTCGCCCATCCCCTTCCCCAGCGTGTCGTATAAACATGAC
ACCAAGATTCTGATCCTGGCCCTCGAGCGCCTGAGAGAGGCTTACTCCGTCAAGGGTCGCCTCAATCAGAGCCAG
AGAGAAGAGCTGGCTCTGATAGAGCAAGCCTACGACAGCCCGGGCACCACGCTCGAGAGGATCAAGCGATTCCTG
CTCACGCAGCGGGCGTTCAAAGAAGTCAACATTGACATGAACGACAACTACAGCACCATCAACCCAGTCTACGAC
ATTGAGCCGATTGAGAAGATAAGCGACGCCTACCTGGATCAGTACCTCTGGTATCAGGCCGATCAGAGACACCTC
TTCCCCGCCTGGATCAAGCCGTCCGACTCCGAGGTGCCGCCGCTGCTGGTCTTCAAGTGGGCGCAGGGCATCAAC
AACCTAGGCCAGGTCTGGGAAACCAAGGACGGCGAATGCAACGTTATGATCGAAACAGAACTATCCAAGGTCTAC
GAAAAGATGGAGTTGACCCTACTCAACTCGCTGCTGAGACTCATCATGGACCACAACTTGGCCGATTACATCACC
GCCAAGAACAACGTGCAGCTCACGTACAAGGACATGAATCACGTCAACAGCTACGGCATGATCCGCGGCCTCCAG
TTCGCGGCCTTCGTGTTCCAGTATTACGGCCTGGTCCTGGATCTCTTACTGCTGGGACCGCAGCGAGCGAGCGAG
ATTGCCGGCTCGCCCCAGAGCCCCAACGACTTTCTGCAGTTCCGGGATAGGGAGACGGAGTGCAGGCATCCCATC
CGCTTGTACTCGCGCTACATCGACAAGATCTGGGTGTTTCTGCGCTTTACGGCCGAGGAGTCGAGAGATCTCATT
CAGCGCTTCCTCACCGAGCAGCCCGATCCCAACTTTGAGAATGTCATCGGATACAAGAGCAAGAAGTGTTGGCCG
CGCGACTCCCGCATGCGCCTGATGCGGCACGATGTGAATCTCGGCCGAGCCGTCTTCTGGGATCTGAAGAACCGG
CTGCCCCGATCCGTGACGACCATCGACTGGGACGACAGTTTCGTCAGCGTGTACAGCCGCGACAACCCTAACCTC
TTGTTCTCCATGTGCGGATTCGAAGTCAGGATCCTCCCCAAGATCAGAAACAAGAACGACGAGTTTCCCATCAAG
GACAGCGTGTGGTCGCTGGTTGACAACACGACCAAGGAGAGGACCGCGTATGCCTTTCTTCAGGTGACGGAACAA
GACATTCAAAAGTTCAATAACCGCATTCGACAGATCCTCATGTCGTCCGGCTCTACTACCTTTACCAAGATTGCC
AACAAGTGGAACACGGCCCTGATTGCGCTCTTTACCTACTATCGCGAGGCCGCCGTCTCCACCATCAATCTCTTG
GACACGATTGTCAAGTGCGAGACCAAGATTCAAACCCGAGTCAAGATAGGGCTCAACTCCAAGATGCCTTCGCGC
TTCCCTCCCGCCGTGTTCTACACGCCCAAGGAGCTGGGCGGCCTGGGCATGATCTCCGGCTCTCACATACTCATC
CCCGCCAGCGACAAGCGTTGGTCCAAGCAGACCGACACCGGCGTCACGCATTACCGAGCCGGCATGTCGCATGAC
GAGGAGACGCTCATCCCCAACATCTTCCGGTACATCATTCCTTGGGAAGCCGAGTTCATCGACTCGCAGCGAGTG
TGGACGGAATACTCGCAGAAGCGCCTCGAGGCGAACCAGCAGAATCGCCGGTTGACGCTCGAAGACCTCGAGGAT
AGTTGGGATCGAGGTCTGCCCAGAATCAACACGCTCTTCCAGAAGGATCGGAGCACTCTGAGCTTCGACAAGGGC
TACCGGGCTCGTTCGGAGTTCAAGGTGTACCAGCTCATGAAGAGTAACCCGTTCTGGTGGACGAGCCAGCGGCAC
GACGGAAAGCTGTGGAATCTCAACGCCTACCGGACCGACGTCATCCAGGCGCTGGGCGGAGTGGAAACGATCCTG
GAGCACACCCTTTTCAAGGCGACGGGGTTCCCCTCGTGGGAGGGTCTCTTCTGGGAGAAGGCTTCCGGGTTCGAG
GAATCGATGAAGTTCAAAAAGCTCACAAACGCCCAGAGGTCGGGCCTCAACCAGATTCCTAACCGTCGTTTCACT
CTCTGGTGGTCGCCCACCATCAACCGCGCCAACGTCTACGTCGGTTTCCAGGTGCAGCTCGATCTTACCGGCATC
TTCTTGCACGGAAAGATCCCGACGCTCAAGATCTCGCTCATCCAGATCTTCCGGGCGCATTTGTGGCAGAAGATT
CACGAGTCGGTCGTCATGGACCTGTGTCAAGTCTTTGACCAGGAGCTGGAGTCTTTGGGGATCGAAACGGTGCAG
AAGGAGACTATCCATCCGCGCAAGTCGTACAAGATGAACAGCTCCTGTGCCGATATCCTACTCTTTGCCAGCCAC
AAGTGGAACGTGACGCGGCCGTCGCAGCTTCACGATACCAAGGACACGATCGAGCCGACGACGACCAACAAGTTC
TGGATCGACGTTCAGCTGCGCTACGGAGACTACGACTCGCACGACATCGAGCGGTACACGCGCGCCAAATATCTC
GACTATACGACCGACAGCGCCAGCATCTATCCGTCGGCCACGGGGCTCATGATCGGCATCGATCTCGCGTATAAC
CTGTACGCTGCGTTCGGCATGTACTTTCCCGGGCTCAAGGTGCTGGTCCAGCAAGCCATGGCGAAGATTATGAAG
GCGAATCCCGCGCTATACGTGCTGCGCGAGCGCATTCGCAAGGGCTTGCAGTTGTACGCGTCGGAGAGCAACCAG
GAGTTCCTCAACTCGCAGAACTACTCGGAGTTATTCAGCAACCAGATTCAGCTGTTCATCGACGACACCAATGTC
TACCGCGTCACCATCCACAAGACATTCGAGGGCAACTTGACGACCAAGCCCATCAACGGAGCCATCTTCATCTTC
AACCCCAGGACCGGACAGCTCTTCCTCAAGATCATCCACACGAGCGTCTGGGCGGGACAGAAGCGTCTCGGACAG
CTGGCCAAGTGGAAGACGGCGGAAGAGGTGGCGGCTCTGATCAGGTCTCTGCCGGTGGAGGAGCAGCCTAGACAG
CTCATCGTCACGCGCAAGGGCCTGTTGGACCCCCTGGAGGTGCAGCTGGTCGACTTCCCCAACATCTCGATCCGG
GCGTCGGAACTGCAGCTCCCGTTCCAGGCGGCGATGAAGGTGGAGAAGCTGGGAGACATGATCCTGCGGGCGACG
GAGCCTCAGATGGTGCTGTTCAACCTGTACGACGAATGGCTGAAGACCATCTCGTCCTACACGGCCTTTTCCCGG
CTGATTCTCATTCTGCGCGCTCTCCACGTCAACCCAGACAAGACCAAGATGATTCTGCGGCCGGACAAGACGGTC
ATTACTCTGGATCACCACATCTGGCCGTCGCTGACGGACGAGGAATGGATCAAGGTGGAAACGCAGCTGCGAGAC
CTGATACTCAACGACTACGGCAAGAAGAACAACGTCAACGTATCGAGCCTGACGAGCAGCGAAGTGCGCGACATC
ATCTTGGGCATGGAGATATCGGCGCCTTCGATGCAGAGGCAGCAGGCGGCAGAGATTGAGAAGCAGCAGCAGGAA
CAGCAGCAGCTGACTGCGGTGACGACCAAGACGCAGAACGTGCACGGCGAAGACATAATCGTGACGACGACGTCG
CAGTTTGAGCAGCAGACGTTTGCGTCCAAGACGGAGTGGCGGACGAGGGCCATTGCCACGTCGAATCTACGGGCG
AGGACCAAGAACATCTACATATCGTCGGTGGACAACGACATGGAGGAGACGACGTACGTGATGCCCAACAACATC
ATCAAGCGCTTCATCACCATTGCCGATCTGCGCGTGCAGGTGGCCGGTTATCTGTACGGATCCCCGCCGCCGGAC
AACGATCAGGTGATGGAGATTCGGTGCATCGTCATGGTACCGCAGATCGGCGGCCTCCGCAACGTCCAGTTGCCG
CAGCAGCTGCCGCAGAGCCCGCTGCTGGAAGGGCTCGAGCCGCTGGGTGTCATCCACACCGTCTCGGGCAACGAG
CTGTCTTACATGTCGGCGCCGGACGTGACGGCACACGCGCGGCTGCTGGACTCGCACCAGACGTGGGACAAGTCG
AACACGGTGACCGTATCCGTCTCCTTCACGCCAGGCAGCGTCTCGCTCTCGGCATGGGGCCTCACGCCTCAGGGG
TACCAAATGGGGGCGGAAAACAGGGACCTGCAGAGCGACCAGCCTCACGGATTCACGACGACCATGGGGGAGAAG
CGCAAGCTGTTGCTGAGCCCTCGATTCCGGGGCTTCTTCCTGGTGCCGGACGACGGCAGATGGAACTACAGTTTC
ATGGGGAGCGCCTTCGCCGGCATGGACAAGAAGCCGGTTCCCGTCAAGCTGGATACGCCGATGCCCTTTTACAGT
GACCAGCATCGGCCGGTACACTTCCAGAGCTTTGCCGAGTTCGAGGACATTTGGGTCGATCGGGCCGATAACTTT
GAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail