Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06006
Gene name
Locationscaffold_07:372799..375470
Strand-
Gene length (bp)2671
Transcript length (bp)1425
Coding sequence length (bp)1425
Protein length (aa) 475

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 1.2E-07 350 395

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2524 0.9056 0.0783 0.018 0.1281 0.0069 0.0552 0.037 0.0218 0.0266

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup888
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|508
Ophiocordyceps australis map64 (Brazil) OphauB2|1418
Ophiocordyceps camponoti-floridani Ophcf2|06006 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|408
Ophiocordyceps kimflemingae Ophio5|6171
Ophiocordyceps subramaniannii Hirsu2|553
Ophiocordyceps subramaniannii Hirsu2|6100

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06006
MLSDPETGGKHRHTCFGHLSPSSITSGYSKYQLRVRAGSERRKGGRERRLSCPLTAWRPSRVEGSGGTHGQSSHT
SGLTQQLQHAYSPSPAHHHQSQTSTAYQPSPSQLPPPPPPPPLPPASAHAHHHHQPQNPYQHHHHHHHHQASPVQ
QPAQTQQTPIKQRQSPQHPSPVHLPGVCPTASARTAEASSHGHLPSLAMGGVMSSQKQADQVGQGSVSQASMESL
QGHRLGHVPFGAASNNVSTPLYGAVSSPNQSPYASYSALPGKRSRPDDFDLTVAVVDAATGLEGVTTGYGSEPTQ
MHHHHHHLPDLGPPSKTMRRDEAGGAAPSMVGQVGMPAPAARPRGPKLKFTAEDDQLLIELKEQKNLTWKQIADF
FPGRSSGTLQVRYCTKLKAKTTLWTDDMDQKLRKSLQDYENEKWRIVAHKVGSGFTPAACRERASQLVGEEPEQL
WQSLSPKAASLPESMELSHSQRPW*
Coding >Ophcf2|06006
ATGCTTTCTGATCCCGAGACGGGGGGCAAGCATCGTCACACATGTTTTGGACATCTCAGCCCGTCATCTATAACG
TCCGGTTATAGCAAATACCAGCTTCGCGTCAGAGCCGGCAGCGAGAGACGCAAGGGGGGCCGAGAGAGACGTCTG
TCGTGTCCGCTCACAGCGTGGAGGCCGTCCAGGGTCGAGGGCTCTGGCGGAACCCATGGTCAGAGTTCGCATACG
AGCGGACTGACGCAGCAGCTCCAGCACGCATACTCGCCTTCTCCGGCACATCATCACCAGTCTCAGACTTCGACG
GCGTATCAGCCTTCGCCGTCTCAGCTGCCTCCGCCTCCGCCTCCTCCTCCGCTCCCTCCGGCTTCCGCTCATGCC
CATCACCATCACCAGCCTCAGAATCCTTACCAGCACCATCATCACCATCATCACCACCAGGCCTCGCCGGTCCAG
CAGCCAGCGCAAACGCAGCAGACGCCCATCAAACAAAGACAGTCGCCGCAGCATCCGTCTCCCGTCCACCTGCCT
GGCGTGTGTCCGACGGCTTCGGCGAGAACGGCCGAGGCGTCGTCTCATGGCCACCTGCCGAGTCTCGCCATGGGG
GGCGTCATGAGCAGCCAGAAACAGGCTGACCAGGTCGGTCAGGGTTCCGTGTCGCAGGCGTCCATGGAGAGCCTC
CAGGGCCATCGACTGGGTCACGTTCCCTTTGGAGCGGCCAGCAACAACGTGTCGACACCGCTGTACGGGGCCGTC
TCGTCACCGAACCAGTCGCCCTACGCGTCCTATAGCGCTCTCCCCGGCAAACGGTCACGGCCAGACGACTTCGAC
CTCACGGTGGCCGTCGTGGACGCTGCGACGGGCCTCGAGGGCGTGACGACGGGTTACGGATCGGAACCGACGCAG
ATGCACCATCATCACCACCATTTGCCAGATCTTGGCCCGCCCTCCAAGACGATGCGCCGTGACGAGGCCGGGGGC
GCGGCGCCGAGCATGGTCGGACAAGTGGGGATGCCGGCTCCGGCGGCTCGGCCTCGGGGACCCAAGCTCAAGTTC
ACGGCCGAGGACGACCAGCTGCTGATCGAGCTCAAGGAGCAGAAGAACCTGACGTGGAAGCAGATTGCAGACTTC
TTTCCGGGCCGGTCATCGGGCACGCTGCAGGTGCGGTACTGCACCAAGCTCAAGGCCAAGACTACGCTGTGGACC
GACGACATGGATCAGAAGCTACGCAAGTCGCTGCAAGACTACGAGAACGAGAAGTGGCGTATCGTCGCCCACAAG
GTCGGCTCCGGCTTCACACCGGCGGCCTGCCGAGAGAGGGCCAGCCAGCTGGTGGGCGAGGAGCCGGAGCAGCTA
TGGCAGTCGCTGTCACCCAAGGCGGCGTCTCTTCCGGAGTCGATGGAGCTGTCGCATTCGCAGCGGCCGTGGTAG
Transcript >Ophcf2|06006
ATGCTTTCTGATCCCGAGACGGGGGGCAAGCATCGTCACACATGTTTTGGACATCTCAGCCCGTCATCTATAACG
TCCGGTTATAGCAAATACCAGCTTCGCGTCAGAGCCGGCAGCGAGAGACGCAAGGGGGGCCGAGAGAGACGTCTG
TCGTGTCCGCTCACAGCGTGGAGGCCGTCCAGGGTCGAGGGCTCTGGCGGAACCCATGGTCAGAGTTCGCATACG
AGCGGACTGACGCAGCAGCTCCAGCACGCATACTCGCCTTCTCCGGCACATCATCACCAGTCTCAGACTTCGACG
GCGTATCAGCCTTCGCCGTCTCAGCTGCCTCCGCCTCCGCCTCCTCCTCCGCTCCCTCCGGCTTCCGCTCATGCC
CATCACCATCACCAGCCTCAGAATCCTTACCAGCACCATCATCACCATCATCACCACCAGGCCTCGCCGGTCCAG
CAGCCAGCGCAAACGCAGCAGACGCCCATCAAACAAAGACAGTCGCCGCAGCATCCGTCTCCCGTCCACCTGCCT
GGCGTGTGTCCGACGGCTTCGGCGAGAACGGCCGAGGCGTCGTCTCATGGCCACCTGCCGAGTCTCGCCATGGGG
GGCGTCATGAGCAGCCAGAAACAGGCTGACCAGGTCGGTCAGGGTTCCGTGTCGCAGGCGTCCATGGAGAGCCTC
CAGGGCCATCGACTGGGTCACGTTCCCTTTGGAGCGGCCAGCAACAACGTGTCGACACCGCTGTACGGGGCCGTC
TCGTCACCGAACCAGTCGCCCTACGCGTCCTATAGCGCTCTCCCCGGCAAACGGTCACGGCCAGACGACTTCGAC
CTCACGGTGGCCGTCGTGGACGCTGCGACGGGCCTCGAGGGCGTGACGACGGGTTACGGATCGGAACCGACGCAG
ATGCACCATCATCACCACCATTTGCCAGATCTTGGCCCGCCCTCCAAGACGATGCGCCGTGACGAGGCCGGGGGC
GCGGCGCCGAGCATGGTCGGACAAGTGGGGATGCCGGCTCCGGCGGCTCGGCCTCGGGGACCCAAGCTCAAGTTC
ACGGCCGAGGACGACCAGCTGCTGATCGAGCTCAAGGAGCAGAAGAACCTGACGTGGAAGCAGATTGCAGACTTC
TTTCCGGGCCGGTCATCGGGCACGCTGCAGGTGCGGTACTGCACCAAGCTCAAGGCCAAGACTACGCTGTGGACC
GACGACATGGATCAGAAGCTACGCAAGTCGCTGCAAGACTACGAGAACGAGAAGTGGCGTATCGTCGCCCACAAG
GTCGGCTCCGGCTTCACACCGGCGGCCTGCCGAGAGAGGGCCAGCCAGCTGGTGGGCGAGGAGCCGGAGCAGCTA
TGGCAGTCGCTGTCACCCAAGGCGGCGTCTCTTCCGGAGTCGATGGAGCTGTCGCATTCGCAGCGGCCGTGGTAG
Gene >Ophcf2|06006
ATGCGTCTGTCTACATCCATCCATCCATCCATACAAACATACGTACAACTTACTCCTCTCTACATACATACATAC
ATACCTTGGTCGCTTACTCGTTGTTCGGCGCACGGCAGCATGGATCAGCAGCAGGCCATGGGGACTTCAGACGAT
GGCTATCGCTACACCCCCCCCCCCCCCCCAGCTCACGGTCCCCGCTGCCGTGTCCCGGTCCTCCCCGGGGGCGTC
GACAATTGCACCTCTTGGCGGTTGTTCTCTTTGCGAAGCCGCCGACAACAAGTGGACTCGAGAATGCACCTCCTC
CGTCCAACGAGAGGCCCAAGGGGACCCAAGGCACAACCTCGCCGGATTATTCCCCGATGTTCACCGTAGCCGCCT
CTCCGCAGCTGCTCTTCGCTACGCGGGCCGGCTGGCCGAGGGCTGGCCACACCGGCGCCAAGCTCGAGACCCACG
TACCGGCATCCTCGATGGACAGCCTTGTCCGTCCTACTACAATAACTCTTTGGTTCTTTGTTCCTCCCCCCCCCC
CCCCCCCCTCCTCTCTCTCTTCCTCTTCGAGCGCGTCTCTCCCAGTCATAGCACAACACACGCCCCCCCCCTCCC
CGTCTTCTTCCCTCTCTCTCTCTCATCACCCTCTCCACTCATTTACCCTCCCCCCTCTTCCCCGATTTATCCATC
TCCTTTCCAGTACAACGTATAATTACGATTTTGCTCAGCTCCGACGGACCTGGTGGTATGCTTTCTGGTTGGATC
GACTGCTGCATCTGGCAGCATTGACAGAAAAGAAGAAGCCGACGACGAGACGAGAACGAAGACGACTTTGGCAAT
AGAATCATCATCATCATCACCATCATCACCGCCTACCTTTTCCACAAACAACGTCGCCGTTGTCTGTACTCGCCG
ACGCTGGAATTGTGCTTCTCGCCAGCCGCCGGTCATCCTGGACGACGTCTCCAGGGGAGTCTAGTTTCTGATCCC
GAGACGGGGGGCAAGCATCGTCACACATGTTTTGGACATCTCAGCCCGTCATCTATAACGTCCGGTTATAGCAAA
TAGTAAGTCCCGACGCTGCCCGTTCTTCAATTCGTAGACGGCTCCCATCCATATAGAGCTGGTTGCTACTGTTTT
TGACCCCCTTGTCTCCTTTTTTTCCTTTTCCGCGGTTCGAAGCAGACCCTGATGCTGGGAGCGGTCGAGGAAAAC
GCTGACAGACATGGATAGCCAGCTTCGCGTCAGAGCCGGCAGCGAGAGACGCAAGGGGGGCCGAGAGAGACGTCT
GTCGTGTCCGCTCACAGCGTGGAGGCCGTCCAGGGTCGAGGGCTCTGGCGGAACCCATGGGTGGGAGTCACGCTG
GCGGACAACTATCGAGTCGGCGGCTATAATGTGGACTACTCTAGTCAGAGTTCGCATACGAGCGGACTGACGCAG
CAGCTCCAGCACGCATACTCGCCTTCTCCGGCACATCATCACCAGTCTCAGACTTCGACGGCGTATCAGCCTTCG
CCGTCTCAGCTGCCTCCGCCTCCGCCTCCTCCTCCGCTCCCTCCGGCTTCCGCTCATGCCCATCACCATCACCAG
CCTCAGAATCCTTACCAGCACCATCATCACCATCATCACCACCAGGCCTCGCCGGTCCAGCAGCCAGCGCAAACG
CAGCAGACGCCCATCAAACAAAGACAGTCGCCGCAGCATCCGTCTCCCGTCCACCTGCCTGGCGTGTGTCCGACG
GCTTCGGCGAGAACGGCCGAGGCGTCGTCTCATGGCCACCTGCCGAGTCTCGCCATGGGGGGCGTCATGAGCAGC
CAGAAACAGGCTGACCAGGTCGGTCAGGGTTCCGTGTCGCAGGCGTCCATGGAGAGCCTCCAGGGCCATCGACTG
GGTCACGTTCCCTTTGGAGCGGCCAGCAACAACGTGTCGACACCGCTGTACGGGGCCGTCTCGTCACCGAACCAG
TCGCCCTACGCGTCCTATAGCGCTCTCCCCGGCAAACGGTCACGGCCAGACGACTTCGACCTCACGGTGGCCGTC
GTGGACGCTGCGACGGGCCTCGAGGGCGTGACGACGGGTTACGGATCGGAACCGACGCAGATGCACCATCATCAC
CACCATTTGCCAGATCTTGGCCCGCCCTCCAAGACGATGCGCCGTGACGAGGCCGGGGGCGCGGCGCCGAGCATG
GTCGGACAAGTGGGGATGCCGGCTCCGGCGGCTCGGCCTCGGGGACCCAAGCTCAAGTTCACGGCCGAGGACGAC
CAGCTGCTGATCGAGCTCAAGGAGCAGAAGAACCTGACGTGGAAGCAGATTGCAGACTTCTTTCCGGGCCGGTCA
TCGGGCACGCTGCAGGTGCGGTACTGCACCAAGCTCAAGGCCAAGACTACGCTGTGGACCGACGACATGGTAAGT
CGAGAACGAGTGGTCGGACGAGGTATGAGACGTGCTGAGACGATGGGGCCATCAGGATCAGAAGCTACGCAAGTC
GCTGCAAGACTACGAGAACGAGAAGTGGCGTATCGTCGCCCACAAGGTCGGCTCCGGCTTCACACCGGCGGCCTG
CCGAGAGAGGGCCAGCCAGCTGGTGGGCGAGGAGCCGGAGCAGCTATGGCAGTCGCTGTCACCCAAGGCGGCGTC
TCTTCCGGAGTCGATGGAGCTGTCGCATTCGCAGCGGCCGTGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail