Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06003
Gene name
Locationscaffold_07:366632..368748
Strand+
Gene length (bp)2116
Transcript length (bp)1878
Coding sequence length (bp)1878
Protein length (aa) 626

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03999 MAP65_ASE1 Microtubule associated protein (MAP65/ASE1 family) 1.4E-59 143 459

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.8163 0.5769 0.0618 0.0767 0.118 0.0024 0.0443 0.246 0.1457 0.0063

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 62.26 35.80 88.72
Alive In ants, during behavior modification 35.89 19.47 52.31
Dead In ants, recently dead 64.36 34.94 93.78

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.004221 yes
Alive Dead 0.000454 yes
Dead Fungus 0.891021 no

Orthologs

Orthofinder run ID4
Orthogroup3501
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7545
Ophiocordyceps australis map64 (Brazil) OphauB2|1414
Ophiocordyceps camponoti-floridani Ophcf2|06003 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|412
Ophiocordyceps kimflemingae Ophio5|6174
Ophiocordyceps subramaniannii Hirsu2|6692

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06003
MDRLVNQVKVGVGQLRALLDDMGVAPHEREAREEELFTAMMDALEDRVRSVDAEKRDMIEQVQHTMAVIRQMEAS
LEGSRPASRDDELTISFPLSRCLQIVREKHAHVGRLHRERFEQIKKLVDALVSYSSHLEPSFFTRVYEEYTRRIS
TVQSLSHQIIQLWAELGTPQAQQDGAIVKYYRDAPEQLGLHDEDLSRLQAKRDRLSEEKARRERRLGELRSAVEL
LWEKLGVDEADMRSFLSRNRGCGVRQINEFEDELGRLDELKRQNLHLFVEDARVQLQDLWDALYFSEDEMLEFTP
AFSDVYSDALLEAHEGEIGRLEALRQQRAPMLTLVERHRSLLRDRDELAASSQDASRLMMRGTGNKGEKRDPGKL
LREEKTRKRVAKELPKATAEVKRALGKWEEEYGRPFLVFGERYLDGIEAEDVKRPASSRSKTMAASSSSTSSRPK
STEANYHEAASLRSRPNDGQRHGPQEDQHGQSLPSPRPRPLSSLNNSPERPTPQPASLRGAPLRAPPPKMRTLGP
VPELSASGSNIVRHVEPEDVYDDNHSRTTGSSEYAGSRHTSHTSSTENWETYVDDDSDPEPDASEAYYAKVRAAN
RLQHRRQDATRVISAEWTDEEDAVF*
Coding >Ophcf2|06003
ATGGATAGGCTTGTGAATCAGGTCAAAGTTGGGGTTGGGCAGTTGCGTGCGCTGCTGGATGATATGGGGGTCGCG
CCTCATGAGCGCGAGGCTCGAGAGGAAGAGCTCTTTACAGCCATGATGGACGCGCTGGAGGATCGCGTGCGGAGC
GTCGACGCGGAAAAGAGAGACATGATTGAGCAGGTTCAGCATACCATGGCTGTTATCCGGCAGATGGAGGCTTCG
CTCGAGGGATCAAGACCGGCTTCTCGAGATGACGAGCTGACAATATCATTCCCCTTGTCGCGATGTCTTCAGATT
GTGCGGGAGAAGCACGCGCACGTCGGTCGTCTGCACCGCGAACGCTTCGAGCAGATCAAGAAACTCGTCGACGCC
CTCGTCTCCTACTCATCTCACCTCGAACCCTCCTTCTTCACCCGCGTCTACGAGGAGTACACTCGTCGCATAAGC
ACCGTCCAATCCCTCTCGCATCAAATCATCCAGCTCTGGGCCGAACTCGGAACTCCTCAAGCTCAGCAAGACGGC
GCAATCGTAAAGTACTACCGCGACGCCCCCGAGCAACTCGGCCTCCACGACGAGGATCTCTCGCGTCTACAAGCC
AAGCGCGATCGTCTCTCGGAGGAAAAGGCCCGTCGCGAACGTCGACTCGGCGAGCTGCGGTCTGCGGTCGAGCTT
CTGTGGGAGAAGCTCGGTGTTGACGAGGCTGATATGCGCTCATTCCTAAGTCGCAATCGAGGGTGTGGCGTGAGA
CAGATCAACGAGTTTGAAGATGAACTCGGTCGACTGGATGAACTAAAGAGGCAGAATCTTCACCTCTTCGTCGAA
GATGCTCGAGTCCAACTTCAAGACCTCTGGGACGCCCTCTACTTCTCGGAAGACGAGATGCTGGAATTCACACCC
GCCTTTTCCGACGTCTACAGCGACGCCCTCCTCGAAGCCCACGAAGGAGAAATCGGCCGCCTCGAAGCCCTCCGC
CAACAACGAGCCCCGATGCTCACCCTCGTCGAACGGCACCGAAGCCTCCTCCGTGATCGAGACGAGCTCGCAGCT
TCGAGCCAGGATGCTTCCCGACTGATGATGCGCGGCACGGGGAACAAAGGAGAGAAGCGCGATCCGGGAAAGTTG
CTGCGCGAGGAGAAGACGCGTAAGAGGGTGGCAAAGGAACTCCCCAAGGCGACGGCCGAGGTCAAGCGCGCGCTG
GGGAAATGGGAGGAGGAATACGGCAGGCCGTTTCTCGTCTTCGGGGAGAGGTATTTGGACGGGATCGAGGCTGAG
GATGTCAAGAGGCCCGCTTCTTCGCGGTCCAAGACGATGGCCGCCTCTTCGTCTTCGACTTCTTCACGGCCGAAG
TCGACGGAAGCGAACTACCACGAAGCCGCCAGCCTCCGATCACGCCCCAACGACGGCCAACGGCACGGCCCCCAA
GAAGATCAACACGGGCAGTCCCTCCCGTCTCCCCGCCCGCGTCCCCTGTCCAGCCTCAACAACTCGCCGGAGAGA
CCCACTCCGCAACCGGCAAGCCTCCGCGGCGCACCGCTCCGAGCCCCCCCCCCCAAGATGCGGACCCTCGGCCCG
GTACCGGAGCTGTCGGCCTCGGGGAGCAACATTGTTCGACACGTCGAGCCGGAGGATGTTTACGATGATAATCAT
AGTCGGACGACGGGGTCGAGCGAGTATGCCGGTTCGCGGCATACGTCTCACACGTCGTCGACGGAGAATTGGGAG
ACGTACGTTGACGACGACTCCGATCCCGAACCCGACGCTTCAGAAGCATACTACGCCAAAGTCAGGGCAGCGAAC
CGGTTGCAGCACAGACGTCAAGACGCTACTCGCGTCATCTCTGCGGAATGGACAGACGAAGAAGATGCCGTCTTC
TGA
Transcript >Ophcf2|06003
ATGGATAGGCTTGTGAATCAGGTCAAAGTTGGGGTTGGGCAGTTGCGTGCGCTGCTGGATGATATGGGGGTCGCG
CCTCATGAGCGCGAGGCTCGAGAGGAAGAGCTCTTTACAGCCATGATGGACGCGCTGGAGGATCGCGTGCGGAGC
GTCGACGCGGAAAAGAGAGACATGATTGAGCAGGTTCAGCATACCATGGCTGTTATCCGGCAGATGGAGGCTTCG
CTCGAGGGATCAAGACCGGCTTCTCGAGATGACGAGCTGACAATATCATTCCCCTTGTCGCGATGTCTTCAGATT
GTGCGGGAGAAGCACGCGCACGTCGGTCGTCTGCACCGCGAACGCTTCGAGCAGATCAAGAAACTCGTCGACGCC
CTCGTCTCCTACTCATCTCACCTCGAACCCTCCTTCTTCACCCGCGTCTACGAGGAGTACACTCGTCGCATAAGC
ACCGTCCAATCCCTCTCGCATCAAATCATCCAGCTCTGGGCCGAACTCGGAACTCCTCAAGCTCAGCAAGACGGC
GCAATCGTAAAGTACTACCGCGACGCCCCCGAGCAACTCGGCCTCCACGACGAGGATCTCTCGCGTCTACAAGCC
AAGCGCGATCGTCTCTCGGAGGAAAAGGCCCGTCGCGAACGTCGACTCGGCGAGCTGCGGTCTGCGGTCGAGCTT
CTGTGGGAGAAGCTCGGTGTTGACGAGGCTGATATGCGCTCATTCCTAAGTCGCAATCGAGGGTGTGGCGTGAGA
CAGATCAACGAGTTTGAAGATGAACTCGGTCGACTGGATGAACTAAAGAGGCAGAATCTTCACCTCTTCGTCGAA
GATGCTCGAGTCCAACTTCAAGACCTCTGGGACGCCCTCTACTTCTCGGAAGACGAGATGCTGGAATTCACACCC
GCCTTTTCCGACGTCTACAGCGACGCCCTCCTCGAAGCCCACGAAGGAGAAATCGGCCGCCTCGAAGCCCTCCGC
CAACAACGAGCCCCGATGCTCACCCTCGTCGAACGGCACCGAAGCCTCCTCCGTGATCGAGACGAGCTCGCAGCT
TCGAGCCAGGATGCTTCCCGACTGATGATGCGCGGCACGGGGAACAAAGGAGAGAAGCGCGATCCGGGAAAGTTG
CTGCGCGAGGAGAAGACGCGTAAGAGGGTGGCAAAGGAACTCCCCAAGGCGACGGCCGAGGTCAAGCGCGCGCTG
GGGAAATGGGAGGAGGAATACGGCAGGCCGTTTCTCGTCTTCGGGGAGAGGTATTTGGACGGGATCGAGGCTGAG
GATGTCAAGAGGCCCGCTTCTTCGCGGTCCAAGACGATGGCCGCCTCTTCGTCTTCGACTTCTTCACGGCCGAAG
TCGACGGAAGCGAACTACCACGAAGCCGCCAGCCTCCGATCACGCCCCAACGACGGCCAACGGCACGGCCCCCAA
GAAGATCAACACGGGCAGTCCCTCCCGTCTCCCCGCCCGCGTCCCCTGTCCAGCCTCAACAACTCGCCGGAGAGA
CCCACTCCGCAACCGGCAAGCCTCCGCGGCGCACCGCTCCGAGCCCCCCCCCCCAAGATGCGGACCCTCGGCCCG
GTACCGGAGCTGTCGGCCTCGGGGAGCAACATTGTTCGACACGTCGAGCCGGAGGATGTTTACGATGATAATCAT
AGTCGGACGACGGGGTCGAGCGAGTATGCCGGTTCGCGGCATACGTCTCACACGTCGTCGACGGAGAATTGGGAG
ACGTACGTTGACGACGACTCCGATCCCGAACCCGACGCTTCAGAAGCATACTACGCCAAAGTCAGGGCAGCGAAC
CGGTTGCAGCACAGACGTCAAGACGCTACTCGCGTCATCTCTGCGGAATGGACAGACGAAGAAGATGCCGTCTTC
TGA
Gene >Ophcf2|06003
ATGGATAGGCTTGTGAATCAGGTCAAAGTTGGGGTTGGGCAGTTGCGTGCGCTGCTGGATGATATGGGGGTCGCG
CCTCATGAGCGCGAGGCTCGAGAGGAAGAGGTGAGGTCATCTGATTTCGGAAGGATAGGTATGGTCTCTGACGAG
GTTGTAGCTCTTTACAGCCATGATGGACGCGCTGGAGGATCGCGTGCGGAGCGTCGACGCGGAAAAGAGAGACAT
GATTGAGCAGGTTCAGCATACCATGGCTGTTATCCGGCAGATGGAGGCTTCGCTCGAGGGATCAAGACCGGCTTC
TCGAGATGACGAGCTGACAATATCATTCCCCTTGTCGCGATGTCTTCAGATTGTGCGGGAGAAGCACGCGCACGT
CGGTCGTCTGCACCGCGAACGCTTCGAGCAGATCAAGAGTAAGCAAAAAGCATCACGGGATAGATGCCCCAGCTA
ATCCTCACAGAACTCGTCGACGCCCTCGTCTCCTACTCATCTCACCTCGAACCCTCCTTCGTGCAAATCGCCCTC
CCCCCAACAGACACAATCCCCCCCCAACCTTGGACCTCTCCCCAACCTACGTCGACAAACTCGACGCCGAGTTCA
CCCGCGTCTACGAGGAGTACACTCGTCGCATAAGCACCGTCCAATCCCTCTCGCATCAAATCATCCAGCTCTGGG
CCGAACTCGGAACTCCTCAAGCTCAGCAAGACGGCGCAATCGTAAAGTACTACCGCGACGCCCCCGAGCAACTCG
GCCTCCACGACGAGGATCTCTCGCGTCTACAAGCCAAGCGCGATCGTCTCTCGGAGGAAAAGGCCCGTCGCGAAC
GTCGACTCGGCGAGCTGCGGTCTGCGGTCGAGCTTCTGTGGGAGAAGCTCGGTGTTGACGAGGCTGATATGCGCT
CATTCCTAAGTCGCAATCGAGGGTGTGGCGTGAGACAGATCAACGAGTTTGAAGATGAACTCGGTCGACTGGATG
AACTAAAGAGGCAGAATCTTCACCTCTTCGTCGAAGATGCTCGAGTCCAACTTCAAGACCTCTGGGACGCCCTCT
ACTTCTCGGAAGACGAGATGCTGGAATTCACACCCGCCTTTTCCGACGTCTACAGCGACGCCCTCCTCGAAGCCC
ACGAAGGAGAAATCGGCCGCCTCGAAGCCCTCCGCCAACAACGAGCCCCGATGCTCACCCTCGTCGAACGGCACC
GAAGCCTCCTCCGTGATCGAGACGAGCTCGCAGCTTCGAGCCAGGATGCTTCCCGACTGATGATGCGCGGCACGG
GGAACAAAGGAGAGAAGCGCGATCCGGGAAAGTTGCTGCGCGAGGAGAAGACGCGTAAGAGGGTGGCAAAGGAAC
TCCCCAAGGCGACGGCCGAGGTCAAGCGCGCGCTGGGGAAATGGGAGGAGGAATACGGCAGGCCGTTTCTCGTCT
TCGGGGAGAGGTATTTGGACGGGATCGAGGCTGAGGATGTCAAGAGGCCCGCTTCTTCGCGGTCCAAGACGATGG
CCGCCTCTTCGTCTTCGACTTCTTCACGGCCGAAGTCGACGGAAGCGAACTACCACGAAGCCGCCAGCCTCCGAT
CACGCCCCAAGTCAACAGAACTGAGCCGAGCGAACAGCATCCGCTCAACAGCCACCCGCCCAGCGACGGCCAACG
GCACGGCCCCCAAGAAGATCAACACGGGCAGTCCCTCCCGTCTCCCCGCCCGCGTCCCCTGTCCAGCCTCAACAA
CTCGCCGGAGAGACCCACTCCGCAACCGGCAAGCCTCCGCGGCGCACCGCTCCGAGCCCCCCCCCCCAAGATGCG
GACCCTCGGCCCGGTACCGGAGCTGTCGGCCTCGGGGAGCAACATTGTTCGACACGTCGAGCCGGAGGATGTTTA
CGATGATAATCATAGTCGGACGACGGGGTCGAGCGAGTATGCCGGTTCGCGGCATACGTCTCACACGTCGTCGAC
GGAGAATTGGGAGACGTACGTTGACGACGACTCCGATCCCGAACCCGACGCTTCAGAAGCATACTACGCCAAAGT
CAGGGCAGCGAACCGGTTGCAGCACAGACGTCAAGACGCTACTCGCGTCATCTCTGCGGAATGGACAGACGAAGA
AGATGCCGTCTTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail