Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06003
Gene name
Locationscaffold_07:366632..368748
Strand+
Gene length (bp)2116
Transcript length (bp)1878
Coding sequence length (bp)1878
Protein length (aa) 626

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03999 MAP65_ASE1 Microtubule associated protein (MAP65/ASE1 family) 1.4E-59 143 459

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.8163 0.5769 0.0618 0.0767 0.118 0.0024 0.0443 0.246 0.1457 0.0063

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3501
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7545
Ophiocordyceps australis map64 (Brazil) OphauB2|1414
Ophiocordyceps camponoti-floridani Ophcf2|06003 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|412
Ophiocordyceps kimflemingae Ophio5|6174
Ophiocordyceps subramaniannii Hirsu2|6692

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06003
MDRLVNQVKVGVGQLRALLDDMGVAPHEREAREEELFTAMMDALEDRVRSVDAEKRDMIEQVQHTMAVIRQMEAS
LEGSRPASRDDELTISFPLSRCLQIVREKHAHVGRLHRERFEQIKKLVDALVSYSSHLEPSFFTRVYEEYTRRIS
TVQSLSHQIIQLWAELGTPQAQQDGAIVKYYRDAPEQLGLHDEDLSRLQAKRDRLSEEKARRERRLGELRSAVEL
LWEKLGVDEADMRSFLSRNRGCGVRQINEFEDELGRLDELKRQNLHLFVEDARVQLQDLWDALYFSEDEMLEFTP
AFSDVYSDALLEAHEGEIGRLEALRQQRAPMLTLVERHRSLLRDRDELAASSQDASRLMMRGTGNKGEKRDPGKL
LREEKTRKRVAKELPKATAEVKRALGKWEEEYGRPFLVFGERYLDGIEAEDVKRPASSRSKTMAASSSSTSSRPK
STEANYHEAASLRSRPNDGQRHGPQEDQHGQSLPSPRPRPLSSLNNSPERPTPQPASLRGAPLRAPPPKMRTLGP
VPELSASGSNIVRHVEPEDVYDDNHSRTTGSSEYAGSRHTSHTSSTENWETYVDDDSDPEPDASEAYYAKVRAAN
RLQHRRQDATRVISAEWTDEEDAVF*
Coding >Ophcf2|06003
ATGGATAGGCTTGTGAATCAGGTCAAAGTTGGGGTTGGGCAGTTGCGTGCGCTGCTGGATGATATGGGGGTCGCG
CCTCATGAGCGCGAGGCTCGAGAGGAAGAGCTCTTTACAGCCATGATGGACGCGCTGGAGGATCGCGTGCGGAGC
GTCGACGCGGAAAAGAGAGACATGATTGAGCAGGTTCAGCATACCATGGCTGTTATCCGGCAGATGGAGGCTTCG
CTCGAGGGATCAAGACCGGCTTCTCGAGATGACGAGCTGACAATATCATTCCCCTTGTCGCGATGTCTTCAGATT
GTGCGGGAGAAGCACGCGCACGTCGGTCGTCTGCACCGCGAACGCTTCGAGCAGATCAAGAAACTCGTCGACGCC
CTCGTCTCCTACTCATCTCACCTCGAACCCTCCTTCTTCACCCGCGTCTACGAGGAGTACACTCGTCGCATAAGC
ACCGTCCAATCCCTCTCGCATCAAATCATCCAGCTCTGGGCCGAACTCGGAACTCCTCAAGCTCAGCAAGACGGC
GCAATCGTAAAGTACTACCGCGACGCCCCCGAGCAACTCGGCCTCCACGACGAGGATCTCTCGCGTCTACAAGCC
AAGCGCGATCGTCTCTCGGAGGAAAAGGCCCGTCGCGAACGTCGACTCGGCGAGCTGCGGTCTGCGGTCGAGCTT
CTGTGGGAGAAGCTCGGTGTTGACGAGGCTGATATGCGCTCATTCCTAAGTCGCAATCGAGGGTGTGGCGTGAGA
CAGATCAACGAGTTTGAAGATGAACTCGGTCGACTGGATGAACTAAAGAGGCAGAATCTTCACCTCTTCGTCGAA
GATGCTCGAGTCCAACTTCAAGACCTCTGGGACGCCCTCTACTTCTCGGAAGACGAGATGCTGGAATTCACACCC
GCCTTTTCCGACGTCTACAGCGACGCCCTCCTCGAAGCCCACGAAGGAGAAATCGGCCGCCTCGAAGCCCTCCGC
CAACAACGAGCCCCGATGCTCACCCTCGTCGAACGGCACCGAAGCCTCCTCCGTGATCGAGACGAGCTCGCAGCT
TCGAGCCAGGATGCTTCCCGACTGATGATGCGCGGCACGGGGAACAAAGGAGAGAAGCGCGATCCGGGAAAGTTG
CTGCGCGAGGAGAAGACGCGTAAGAGGGTGGCAAAGGAACTCCCCAAGGCGACGGCCGAGGTCAAGCGCGCGCTG
GGGAAATGGGAGGAGGAATACGGCAGGCCGTTTCTCGTCTTCGGGGAGAGGTATTTGGACGGGATCGAGGCTGAG
GATGTCAAGAGGCCCGCTTCTTCGCGGTCCAAGACGATGGCCGCCTCTTCGTCTTCGACTTCTTCACGGCCGAAG
TCGACGGAAGCGAACTACCACGAAGCCGCCAGCCTCCGATCACGCCCCAACGACGGCCAACGGCACGGCCCCCAA
GAAGATCAACACGGGCAGTCCCTCCCGTCTCCCCGCCCGCGTCCCCTGTCCAGCCTCAACAACTCGCCGGAGAGA
CCCACTCCGCAACCGGCAAGCCTCCGCGGCGCACCGCTCCGAGCCCCCCCCCCCAAGATGCGGACCCTCGGCCCG
GTACCGGAGCTGTCGGCCTCGGGGAGCAACATTGTTCGACACGTCGAGCCGGAGGATGTTTACGATGATAATCAT
AGTCGGACGACGGGGTCGAGCGAGTATGCCGGTTCGCGGCATACGTCTCACACGTCGTCGACGGAGAATTGGGAG
ACGTACGTTGACGACGACTCCGATCCCGAACCCGACGCTTCAGAAGCATACTACGCCAAAGTCAGGGCAGCGAAC
CGGTTGCAGCACAGACGTCAAGACGCTACTCGCGTCATCTCTGCGGAATGGACAGACGAAGAAGATGCCGTCTTC
TGA
Transcript >Ophcf2|06003
ATGGATAGGCTTGTGAATCAGGTCAAAGTTGGGGTTGGGCAGTTGCGTGCGCTGCTGGATGATATGGGGGTCGCG
CCTCATGAGCGCGAGGCTCGAGAGGAAGAGCTCTTTACAGCCATGATGGACGCGCTGGAGGATCGCGTGCGGAGC
GTCGACGCGGAAAAGAGAGACATGATTGAGCAGGTTCAGCATACCATGGCTGTTATCCGGCAGATGGAGGCTTCG
CTCGAGGGATCAAGACCGGCTTCTCGAGATGACGAGCTGACAATATCATTCCCCTTGTCGCGATGTCTTCAGATT
GTGCGGGAGAAGCACGCGCACGTCGGTCGTCTGCACCGCGAACGCTTCGAGCAGATCAAGAAACTCGTCGACGCC
CTCGTCTCCTACTCATCTCACCTCGAACCCTCCTTCTTCACCCGCGTCTACGAGGAGTACACTCGTCGCATAAGC
ACCGTCCAATCCCTCTCGCATCAAATCATCCAGCTCTGGGCCGAACTCGGAACTCCTCAAGCTCAGCAAGACGGC
GCAATCGTAAAGTACTACCGCGACGCCCCCGAGCAACTCGGCCTCCACGACGAGGATCTCTCGCGTCTACAAGCC
AAGCGCGATCGTCTCTCGGAGGAAAAGGCCCGTCGCGAACGTCGACTCGGCGAGCTGCGGTCTGCGGTCGAGCTT
CTGTGGGAGAAGCTCGGTGTTGACGAGGCTGATATGCGCTCATTCCTAAGTCGCAATCGAGGGTGTGGCGTGAGA
CAGATCAACGAGTTTGAAGATGAACTCGGTCGACTGGATGAACTAAAGAGGCAGAATCTTCACCTCTTCGTCGAA
GATGCTCGAGTCCAACTTCAAGACCTCTGGGACGCCCTCTACTTCTCGGAAGACGAGATGCTGGAATTCACACCC
GCCTTTTCCGACGTCTACAGCGACGCCCTCCTCGAAGCCCACGAAGGAGAAATCGGCCGCCTCGAAGCCCTCCGC
CAACAACGAGCCCCGATGCTCACCCTCGTCGAACGGCACCGAAGCCTCCTCCGTGATCGAGACGAGCTCGCAGCT
TCGAGCCAGGATGCTTCCCGACTGATGATGCGCGGCACGGGGAACAAAGGAGAGAAGCGCGATCCGGGAAAGTTG
CTGCGCGAGGAGAAGACGCGTAAGAGGGTGGCAAAGGAACTCCCCAAGGCGACGGCCGAGGTCAAGCGCGCGCTG
GGGAAATGGGAGGAGGAATACGGCAGGCCGTTTCTCGTCTTCGGGGAGAGGTATTTGGACGGGATCGAGGCTGAG
GATGTCAAGAGGCCCGCTTCTTCGCGGTCCAAGACGATGGCCGCCTCTTCGTCTTCGACTTCTTCACGGCCGAAG
TCGACGGAAGCGAACTACCACGAAGCCGCCAGCCTCCGATCACGCCCCAACGACGGCCAACGGCACGGCCCCCAA
GAAGATCAACACGGGCAGTCCCTCCCGTCTCCCCGCCCGCGTCCCCTGTCCAGCCTCAACAACTCGCCGGAGAGA
CCCACTCCGCAACCGGCAAGCCTCCGCGGCGCACCGCTCCGAGCCCCCCCCCCCAAGATGCGGACCCTCGGCCCG
GTACCGGAGCTGTCGGCCTCGGGGAGCAACATTGTTCGACACGTCGAGCCGGAGGATGTTTACGATGATAATCAT
AGTCGGACGACGGGGTCGAGCGAGTATGCCGGTTCGCGGCATACGTCTCACACGTCGTCGACGGAGAATTGGGAG
ACGTACGTTGACGACGACTCCGATCCCGAACCCGACGCTTCAGAAGCATACTACGCCAAAGTCAGGGCAGCGAAC
CGGTTGCAGCACAGACGTCAAGACGCTACTCGCGTCATCTCTGCGGAATGGACAGACGAAGAAGATGCCGTCTTC
TGA
Gene >Ophcf2|06003
ATGGATAGGCTTGTGAATCAGGTCAAAGTTGGGGTTGGGCAGTTGCGTGCGCTGCTGGATGATATGGGGGTCGCG
CCTCATGAGCGCGAGGCTCGAGAGGAAGAGGTGAGGTCATCTGATTTCGGAAGGATAGGTATGGTCTCTGACGAG
GTTGTAGCTCTTTACAGCCATGATGGACGCGCTGGAGGATCGCGTGCGGAGCGTCGACGCGGAAAAGAGAGACAT
GATTGAGCAGGTTCAGCATACCATGGCTGTTATCCGGCAGATGGAGGCTTCGCTCGAGGGATCAAGACCGGCTTC
TCGAGATGACGAGCTGACAATATCATTCCCCTTGTCGCGATGTCTTCAGATTGTGCGGGAGAAGCACGCGCACGT
CGGTCGTCTGCACCGCGAACGCTTCGAGCAGATCAAGAGTAAGCAAAAAGCATCACGGGATAGATGCCCCAGCTA
ATCCTCACAGAACTCGTCGACGCCCTCGTCTCCTACTCATCTCACCTCGAACCCTCCTTCGTGCAAATCGCCCTC
CCCCCAACAGACACAATCCCCCCCCAACCTTGGACCTCTCCCCAACCTACGTCGACAAACTCGACGCCGAGTTCA
CCCGCGTCTACGAGGAGTACACTCGTCGCATAAGCACCGTCCAATCCCTCTCGCATCAAATCATCCAGCTCTGGG
CCGAACTCGGAACTCCTCAAGCTCAGCAAGACGGCGCAATCGTAAAGTACTACCGCGACGCCCCCGAGCAACTCG
GCCTCCACGACGAGGATCTCTCGCGTCTACAAGCCAAGCGCGATCGTCTCTCGGAGGAAAAGGCCCGTCGCGAAC
GTCGACTCGGCGAGCTGCGGTCTGCGGTCGAGCTTCTGTGGGAGAAGCTCGGTGTTGACGAGGCTGATATGCGCT
CATTCCTAAGTCGCAATCGAGGGTGTGGCGTGAGACAGATCAACGAGTTTGAAGATGAACTCGGTCGACTGGATG
AACTAAAGAGGCAGAATCTTCACCTCTTCGTCGAAGATGCTCGAGTCCAACTTCAAGACCTCTGGGACGCCCTCT
ACTTCTCGGAAGACGAGATGCTGGAATTCACACCCGCCTTTTCCGACGTCTACAGCGACGCCCTCCTCGAAGCCC
ACGAAGGAGAAATCGGCCGCCTCGAAGCCCTCCGCCAACAACGAGCCCCGATGCTCACCCTCGTCGAACGGCACC
GAAGCCTCCTCCGTGATCGAGACGAGCTCGCAGCTTCGAGCCAGGATGCTTCCCGACTGATGATGCGCGGCACGG
GGAACAAAGGAGAGAAGCGCGATCCGGGAAAGTTGCTGCGCGAGGAGAAGACGCGTAAGAGGGTGGCAAAGGAAC
TCCCCAAGGCGACGGCCGAGGTCAAGCGCGCGCTGGGGAAATGGGAGGAGGAATACGGCAGGCCGTTTCTCGTCT
TCGGGGAGAGGTATTTGGACGGGATCGAGGCTGAGGATGTCAAGAGGCCCGCTTCTTCGCGGTCCAAGACGATGG
CCGCCTCTTCGTCTTCGACTTCTTCACGGCCGAAGTCGACGGAAGCGAACTACCACGAAGCCGCCAGCCTCCGAT
CACGCCCCAAGTCAACAGAACTGAGCCGAGCGAACAGCATCCGCTCAACAGCCACCCGCCCAGCGACGGCCAACG
GCACGGCCCCCAAGAAGATCAACACGGGCAGTCCCTCCCGTCTCCCCGCCCGCGTCCCCTGTCCAGCCTCAACAA
CTCGCCGGAGAGACCCACTCCGCAACCGGCAAGCCTCCGCGGCGCACCGCTCCGAGCCCCCCCCCCCAAGATGCG
GACCCTCGGCCCGGTACCGGAGCTGTCGGCCTCGGGGAGCAACATTGTTCGACACGTCGAGCCGGAGGATGTTTA
CGATGATAATCATAGTCGGACGACGGGGTCGAGCGAGTATGCCGGTTCGCGGCATACGTCTCACACGTCGTCGAC
GGAGAATTGGGAGACGTACGTTGACGACGACTCCGATCCCGAACCCGACGCTTCAGAAGCATACTACGCCAAAGT
CAGGGCAGCGAACCGGTTGCAGCACAGACGTCAAGACGCTACTCGCGTCATCTCTGCGGAATGGACAGACGAAGA
AGATGCCGTCTTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail