Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06000
Gene name
Locationscaffold_07:359451..360174
Strand-
Gene length (bp)723
Transcript length (bp)723
Coding sequence length (bp)723
Protein length (aa) 241

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6011 0.4167 0.2816 0.1388 0.4356 0.0623 0.1599 0.2758 0.2658 0.0329

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup65
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7300
Ophiocordyceps australis map64 (Brazil) OphauB2|4715
Ophiocordyceps camponoti-floridani Ophcf2|02168
Ophiocordyceps camponoti-floridani Ophcf2|04814
Ophiocordyceps camponoti-floridani Ophcf2|06000 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1467
Ophiocordyceps camponoti-rufipedis Ophun1|169
Ophiocordyceps camponoti-rufipedis Ophun1|6192
Ophiocordyceps kimflemingae Ophio5|2277
Ophiocordyceps kimflemingae Ophio5|3034
Ophiocordyceps kimflemingae Ophio5|960
Ophiocordyceps subramaniannii Hirsu2|10179
Ophiocordyceps subramaniannii Hirsu2|1104
Ophiocordyceps subramaniannii Hirsu2|457
Ophiocordyceps subramaniannii Hirsu2|4942
Ophiocordyceps subramaniannii Hirsu2|7062

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06000
MDRGYLGPTTHLVDTLRRWQAYYNNMELHEAYQQFAKPSLGEVDPWKIVRYSWESRGELCYYGSPPASVDNLSPR
PAALLTFFFSDPRNIRDAYLKIMAQDWKMTSDVVCSGTESSDRKRQASTIANWMAPFYWNKHLSDHYSQSHRAQF
SADPFLQAVLTGWRSGKYRCPGGCGGATEQGRVQVYQPDNSYNYIAFIHLFFEHEIKGRLCVILRPTAAQLEAEN
VYIASYDSAEVFAQQ*
Coding >Ophcf2|06000
ATGGATAGGGGATACCTCGGGCCGACGACCCATCTCGTCGACACGCTCCGTCGCTGGCAGGCCTACTATAACAAC
ATGGAGCTTCACGAGGCTTACCAGCAGTTCGCCAAGCCCAGCCTCGGCGAGGTCGATCCTTGGAAGATTGTGAGG
TATAGCTGGGAGTCGAGGGGCGAGCTTTGCTACTACGGGAGTCCTCCCGCCTCCGTCGATAACCTCAGTCCCCGG
CCCGCAGCCCTGCTCACCTTCTTCTTCAGCGATCCTCGGAACATACGCGATGCCTATCTCAAGATCATGGCTCAG
GACTGGAAGATGACGTCCGACGTCGTCTGCTCCGGCACAGAGTCTTCGGATCGGAAACGACAAGCGTCGACCATC
GCCAACTGGATGGCCCCCTTTTACTGGAACAAGCATCTTTCCGATCATTACAGCCAGAGTCACCGTGCCCAGTTC
TCGGCCGATCCCTTCCTCCAGGCCGTCCTCACCGGCTGGCGATCCGGAAAGTATAGGTGCCCCGGAGGCTGCGGC
GGCGCCACCGAGCAAGGCCGGGTCCAGGTATATCAGCCAGACAACTCGTACAACTACATCGCCTTCATCCACCTG
TTCTTCGAGCACGAGATAAAAGGCCGTCTGTGTGTCATTCTCCGGCCGACGGCGGCGCAGCTGGAAGCCGAGAAT
GTGTACATTGCCTCGTACGATTCCGCCGAGGTGTTTGCCCAACAATGA
Transcript >Ophcf2|06000
ATGGATAGGGGATACCTCGGGCCGACGACCCATCTCGTCGACACGCTCCGTCGCTGGCAGGCCTACTATAACAAC
ATGGAGCTTCACGAGGCTTACCAGCAGTTCGCCAAGCCCAGCCTCGGCGAGGTCGATCCTTGGAAGATTGTGAGG
TATAGCTGGGAGTCGAGGGGCGAGCTTTGCTACTACGGGAGTCCTCCCGCCTCCGTCGATAACCTCAGTCCCCGG
CCCGCAGCCCTGCTCACCTTCTTCTTCAGCGATCCTCGGAACATACGCGATGCCTATCTCAAGATCATGGCTCAG
GACTGGAAGATGACGTCCGACGTCGTCTGCTCCGGCACAGAGTCTTCGGATCGGAAACGACAAGCGTCGACCATC
GCCAACTGGATGGCCCCCTTTTACTGGAACAAGCATCTTTCCGATCATTACAGCCAGAGTCACCGTGCCCAGTTC
TCGGCCGATCCCTTCCTCCAGGCCGTCCTCACCGGCTGGCGATCCGGAAAGTATAGGTGCCCCGGAGGCTGCGGC
GGCGCCACCGAGCAAGGCCGGGTCCAGGTATATCAGCCAGACAACTCGTACAACTACATCGCCTTCATCCACCTG
TTCTTCGAGCACGAGATAAAAGGCCGTCTGTGTGTCATTCTCCGGCCGACGGCGGCGCAGCTGGAAGCCGAGAAT
GTGTACATTGCCTCGTACGATTCCGCCGAGGTGTTTGCCCAACAATGA
Gene >Ophcf2|06000
ATGGATAGGGGATACCTCGGGCCGACGACCCATCTCGTCGACACGCTCCGTCGCTGGCAGGCCTACTATAACAAC
ATGGAGCTTCACGAGGCTTACCAGCAGTTCGCCAAGCCCAGCCTCGGCGAGGTCGATCCTTGGAAGATTGTGAGG
TATAGCTGGGAGTCGAGGGGCGAGCTTTGCTACTACGGGAGTCCTCCCGCCTCCGTCGATAACCTCAGTCCCCGG
CCCGCAGCCCTGCTCACCTTCTTCTTCAGCGATCCTCGGAACATACGCGATGCCTATCTCAAGATCATGGCTCAG
GACTGGAAGATGACGTCCGACGTCGTCTGCTCCGGCACAGAGTCTTCGGATCGGAAACGACAAGCGTCGACCATC
GCCAACTGGATGGCCCCCTTTTACTGGAACAAGCATCTTTCCGATCATTACAGCCAGAGTCACCGTGCCCAGTTC
TCGGCCGATCCCTTCCTCCAGGCCGTCCTCACCGGCTGGCGATCCGGAAAGTATAGGTGCCCCGGAGGCTGCGGC
GGCGCCACCGAGCAAGGCCGGGTCCAGGTATATCAGCCAGACAACTCGTACAACTACATCGCCTTCATCCACCTG
TTCTTCGAGCACGAGATAAAAGGCCGTCTGTGTGTCATTCTCCGGCCGACGGCGGCGCAGCTGGAAGCCGAGAAT
GTGTACATTGCCTCGTACGATTCCGCCGAGGTGTTTGCCCAACAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail