Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05988
Gene name
Locationscaffold_07:324013..325604
Strand-
Gene length (bp)1591
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10255 Paf67 RNA polymerase I-associated factor PAF67 3.6E-157 78 475

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0003743 translation initiation factor activity Yes
GO:0005852 eukaryotic translation initiation factor 3 complex Yes
GO:0005575 cellular_component No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0045182 translation regulator activity No
GO:0008135 translation factor activity, RNA binding No
GO:0032991 protein-containing complex No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 197 219 22
2 232 254 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05988
MASYHNVMGVGAARAIDVDSDVEEEALVAEYKEHVQYEDGEELSQTTSLTMAQQTDDIQARLVQAAQPLDFSAPL
EVKFQSYDSYCSLFHFILNSEGPVDLEPPSYFWAWDVIDEFIYQFNSFSSYRSRIARQANNEEEMQMLRENPNTW
GCYSVLNVLYSLIQRSQITEQLAAMRRNEDPMTVAGEYGSKNLYRMLGYFSIIGLLRVHCLLGDFSLALKTLDDI
ELNKKAMFARVMAAHFTTYYYVGFSYMMMHRYADAIRMFSHILVYVSRTKNFQKNAQYDSITKKNEQMYALIAIC
VAFQPTRLDDTIHGALREKYGDQLLRLQRGGPDALPIFEELFRTACPKFISPVPPDFDNPELNVDPVEYHLSLFM
DEVKTNMWSPTIKSYLRLYTTMDLNKLAGFLEVQPDELRSWLLVTKQRTKQLRWQDQGLVDGELVNVSDLDYAMQ
GDLIHISEAKVGRKLVDWYLRNLSRTYN*
Coding >Ophcf2|05988
ATGGCTTCGTACCACAATGTCATGGGCGTCGGCGCGGCCCGTGCCATCGACGTCGATAGCGATGTCGAGGAGGAG
GCTCTCGTGGCCGAGTACAAGGAGCACGTCCAGTACGAGGACGGTGAGGAGCTGAGCCAGACGACGTCTCTCACC
ATGGCGCAACAAACCGACGACATTCAGGCTCGGCTGGTCCAGGCCGCTCAGCCTCTCGACTTTTCGGCGCCGCTC
GAGGTCAAGTTCCAGAGCTACGACTCGTACTGCAGCCTGTTCCACTTCATCCTCAACTCGGAGGGGCCCGTCGAC
CTCGAGCCCCCCTCGTACTTTTGGGCGTGGGACGTCATCGACGAGTTCATCTACCAGTTCAACTCGTTCAGTTCG
TACCGATCCCGCATCGCGCGGCAGGCCAACAACGAGGAGGAGATGCAGATGCTACGCGAGAACCCAAACACCTGG
GGCTGTTACAGCGTCCTCAACGTCCTCTACTCGCTCATCCAGCGGTCGCAGATTACGGAGCAGCTTGCGGCGATG
CGGCGCAACGAGGACCCCATGACGGTGGCGGGCGAATATGGATCCAAGAACCTGTATAGGATGCTGGGTTACTTT
TCCATCATCGGACTGCTGCGCGTCCACTGCTTGCTGGGCGACTTTAGCCTGGCGCTCAAGACGCTCGACGACATT
GAGCTCAACAAAAAGGCCATGTTTGCGCGCGTCATGGCTGCGCACTTTACCACGTACTACTACGTCGGCTTCTCG
TACATGATGATGCACCGCTACGCCGACGCCATCCGCATGTTCAGCCACATCCTGGTGTACGTGTCGAGGACCAAG
AACTTTCAGAAGAACGCACAGTACGACTCCATCACCAAGAAGAACGAGCAGATGTACGCCCTCATCGCCATCTGC
GTCGCCTTTCAGCCGACCCGGCTCGACGACACGATCCACGGGGCGCTGCGGGAGAAGTACGGAGATCAGCTGCTG
CGGCTGCAGCGCGGGGGCCCCGATGCGCTGCCCATCTTTGAGGAGCTCTTCCGGACGGCCTGTCCCAAGTTCATC
TCGCCGGTTCCGCCCGACTTTGACAATCCGGAGCTCAACGTGGACCCGGTCGAGTATCACCTGTCGCTGTTTATG
GACGAGGTCAAGACCAACATGTGGAGCCCGACGATCAAGTCGTACCTGCGGTTGTACACGACCATGGACCTCAAC
AAGCTGGCGGGGTTCCTGGAAGTTCAGCCGGATGAGCTGCGGTCGTGGCTGTTGGTGACGAAGCAGCGGACGAAG
CAGCTGCGGTGGCAGGACCAGGGTCTGGTGGACGGCGAGCTGGTCAACGTCAGCGACCTCGACTACGCGATGCAG
GGGGATCTGATTCACATCTCGGAGGCCAAGGTTGGCAGGAAGCTAGTGGACTGGTACCTCCGCAACCTGTCACGG
ACGTACAACTAA
Transcript >Ophcf2|05988
ATGGCTTCGTACCACAATGTCATGGGCGTCGGCGCGGCCCGTGCCATCGACGTCGATAGCGATGTCGAGGAGGAG
GCTCTCGTGGCCGAGTACAAGGAGCACGTCCAGTACGAGGACGGTGAGGAGCTGAGCCAGACGACGTCTCTCACC
ATGGCGCAACAAACCGACGACATTCAGGCTCGGCTGGTCCAGGCCGCTCAGCCTCTCGACTTTTCGGCGCCGCTC
GAGGTCAAGTTCCAGAGCTACGACTCGTACTGCAGCCTGTTCCACTTCATCCTCAACTCGGAGGGGCCCGTCGAC
CTCGAGCCCCCCTCGTACTTTTGGGCGTGGGACGTCATCGACGAGTTCATCTACCAGTTCAACTCGTTCAGTTCG
TACCGATCCCGCATCGCGCGGCAGGCCAACAACGAGGAGGAGATGCAGATGCTACGCGAGAACCCAAACACCTGG
GGCTGTTACAGCGTCCTCAACGTCCTCTACTCGCTCATCCAGCGGTCGCAGATTACGGAGCAGCTTGCGGCGATG
CGGCGCAACGAGGACCCCATGACGGTGGCGGGCGAATATGGATCCAAGAACCTGTATAGGATGCTGGGTTACTTT
TCCATCATCGGACTGCTGCGCGTCCACTGCTTGCTGGGCGACTTTAGCCTGGCGCTCAAGACGCTCGACGACATT
GAGCTCAACAAAAAGGCCATGTTTGCGCGCGTCATGGCTGCGCACTTTACCACGTACTACTACGTCGGCTTCTCG
TACATGATGATGCACCGCTACGCCGACGCCATCCGCATGTTCAGCCACATCCTGGTGTACGTGTCGAGGACCAAG
AACTTTCAGAAGAACGCACAGTACGACTCCATCACCAAGAAGAACGAGCAGATGTACGCCCTCATCGCCATCTGC
GTCGCCTTTCAGCCGACCCGGCTCGACGACACGATCCACGGGGCGCTGCGGGAGAAGTACGGAGATCAGCTGCTG
CGGCTGCAGCGCGGGGGCCCCGATGCGCTGCCCATCTTTGAGGAGCTCTTCCGGACGGCCTGTCCCAAGTTCATC
TCGCCGGTTCCGCCCGACTTTGACAATCCGGAGCTCAACGTGGACCCGGTCGAGTATCACCTGTCGCTGTTTATG
GACGAGGTCAAGACCAACATGTGGAGCCCGACGATCAAGTCGTACCTGCGGTTGTACACGACCATGGACCTCAAC
AAGCTGGCGGGGTTCCTGGAAGTTCAGCCGGATGAGCTGCGGTCGTGGCTGTTGGTGACGAAGCAGCGGACGAAG
CAGCTGCGGTGGCAGGACCAGGGTCTGGTGGACGGCGAGCTGGTCAACGTCAGCGACCTCGACTACGCGATGCAG
GGGGATCTGATTCACATCTCGGAGGCCAAGGTTGGCAGGAAGCTAGTGGACTGGTACCTCCGCAACCTGTCACGG
ACGTACAACTAA
Gene >Ophcf2|05988
ATGGCTTCGTACCACAATGTCATGGGCGTCGGCGCGGCCCGTGCCATCGACGTCGATAGCGATGTCGAGGAGGAG
GCTCTCGTGGCCGAGTACAAGGAGCACGTCCAGTACGAGGACGGTGAGGAGCTGAGCCAGACGACGTCTCTCACC
ATGGCGCAACAAACCGACGACATTCAGGCTCGGCTGGTCCAGGCCGCTCAGCCTCTCGACTTTTCGGCGCCGCTC
GAGGTCAAGTTCCAGAGCTACGACTCGTACTGCAGCCTGTTCCACTTCATCCTCAACTCGGAGGGGCCCGTCGAC
CTCGAGCCCCCCTCGGTGCGTAAAGCCGGGAAAGCTGATCCGACCAACTCTGACCAGGCAGCGCAGTACTTTTGG
GCGTGGGACGTCATCGACGAGTTCATCTACCAGTTCAACTCGTTCAGTTCGTACCGATCCCGCATCGCGCGGCAG
GCCAACAACGAGGAGGAGATGCAGATGCTACGCGAGAACCCAAACACCTGGGGCTGTTACAGCGTCCTCAACGTC
CTCTACTCGCTCATCCAGCGGTCGCAGATTACGGAGCAGCTTGCGGCGATGCGGCGCAACGAGGACCCCATGACG
GTGGCGGGCGAATATGGATCCAAGAACCTGTATAGGATGCTGGGTTACTTTTCCATCATCGGACTGCTGCGCGTC
CACTGCTTGCTGGGCGACTTTAGCCTGGCGCTCAAGACGCTCGACGACATTGAGCTCAACAAAAAGGCCATGTTT
GCGCGCGTCATGGCTGCGCACTTTACCACGTACTACTACGTCGGCTTCTCGTACATGATGATGCACCGCTACGCC
GACGCCATCCGCATGTTCAGCCACATCCTGGTGTACGTGTCGAGGACCAAGAACTTTCAGAAGAACGCACAGTAC
GACTCCATCACCAAGAAGAACGAGCAGATGTACGCCCTCATCGCCATCTGCGTCGCCTTTCAGCCGACCCGGCTC
GACGACACGATCCACGGGGCGCTGCGGGAGAAGTACGGAGATCAGCTGCTGCGGCTGCAGCGCGGGGGCCCCGAT
GCGCTGCCCATCTTTGAGGAGCTCTTCCGGACGGCCTGTCCCAAGTTCATCTCGCCGGTTCCGCCCGACTTTGAC
AATCCGGAGCTCAACGTGGACCCGGTCGAGTATCACCTGTCGCTGTTTATGGACGAGGTCAAGACCAACATGTGG
AGCCCGACGATCAAGTCGTACCTGCGGTTGTACACGACCATGGACCTCAACAAGCTGGCGGGGTTCCTGGAAGTT
CAGCCGGATGAGCTGCGGTCGTGGCTGTTGGTGACGAAGCAGCGGACGAAGCAGCTGCGGTGGCAGGACCAGGGT
CTGGTGGACGGCGAGCTGGTCAACGTCAGCGACCTCGACTACGCGATGCAGGGGGTGAGTTTTTTTTTTTTTTTT
TTTTTTTTTTTTTCCCTTTCCCCCCCTCTCTCTCCTCTCTCAACATTCCCCCGGCCGGCGACGGAAGCTGACGGC
GGCGCAGGATCTGATTCACATCTCGGAGGCCAAGGTTGGCAGGAAGCTAGTGGACTGGTACCTCCGCAACCTGTC
ACGGACGTACAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail