Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05982
Gene name
Locationscaffold_07:304408..313951
Strand-
Gene length (bp)9543
Transcript length (bp)9189
Coding sequence length (bp)9189
Protein length (aa) 3063

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10344 Fmp27 Mitochondrial protein from FMP27 1.7E-193 45 922
PF10351 Apt1 Golgi-body localisation protein domain 1.7E-182 2341 2983
PF10359 Fmp27_WPPW RNA pol II promoter Fmp27 protein domain 5.2E-162 1755 2328
PF10347 Fmp27_GFWDK RNA pol II promoter Fmp27 protein domain 6.2E-53 1310 1464
PF10293 DUF2405 Domain of unknown function (DUF2405) 1.8E-47 938 1095
PF10305 Fmp27_SW RNA pol II promoter Fmp27 protein domain 4.3E-28 1191 1292

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 37 59 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05982
MYCPRQHPNLAHRIEIALVGPFALGAAAMALLNPTFLLGLTVLLYLSSFVLFAVIRIVTGVSIQRIGYLSLRRLA
YTPRDGVVIEIRSLGLNVHRPTFAQPTWVSLALNELVVTVDARGQKASKAGGPGDDEDDISTAPSTPDLKPRPDR
SGRENIWSKAAKLRQAVKQLHHYIGWLRLVDVVATNTTVNMVGVGHVQLGSLTVAVDTRRKMVGRSRISRKLSSG
DDGIRQAEWIMTLRSLLFTAEGGESLEVLDHALFNVHGSLHETLGGLRDVTMALKLGSVSVPYDDLVLCAAKMRT
HRQQKEKEKEKGEEDINKKKQDLVGGKKQSKPVPATTTTTAGETDDEDKNEKLMQTVTDSREFFSAILRNIKEVQ
FAVSFAGLTKKMTSIKAATNPMILTASMKEVGIDFHRLDPKSPAHRMYFSPKDIAHEALAAALSISIDLDDGQRG
PQRLFYVPMATTTARTTLPSKTVQLAHESALEERNANILFANSVVTSPSVDLDPVHLPLLIALLRPKPKPAAAQH
GPRQQLISRLLPKASLKLSMHEPVVRIRLKPLQPTTDADDFDLIISSISSVSLDVESSHSPVEDLHYFLDGSLRL
QSHRLYYQTSSGDVFDLMTTDSLDVKTHLAATPDVCVDMTGGVQSFSVSMARQEITDGLRQIVRQLHVDSDQEKA
MTTVRDGKTAPRRRHNFLRAVPEWLTSYHFEATDFNVEVAGVDEDIADEMRGVSLHLDSFSAEYRAHKLDEPQRR
LTRRRAHSRLVSNQSDSDVATPRKKPQTAGDGRRLVLQARGLEAHMVEAVDQLEIEPFVRLPRLELVLSAVSDGL
GPMFHIQATVRTILLQYSLYRHYAVGVAVLTLRKALMRTERDVAPKPRPSCSETRPLPAASAPPGTTELVTVDVR
ASLVQVKANMPHEPAMMLHVYGIEAGRHRWSTPYLATKLVRLFVEPPRMRNVWARVLSVHAGRVDLRESRHKTTM
GGYSEEKMLDVVTEAVRLAVPHEVIVDHIIDNVINTAKAVQQLHHRFHTGTDEFVVEKKPESAKLLPKTSIRSRN
VLLELEDGAFEWKLGIIYRTGRAEQVQRLVRDEAFSLKVAKVRDEASGRGSKGRSRSVMSRGRGAGTLASATTWT
PAQTGAWFRSRSLDRGRTATPTAATSSSTTTTTTTTTAPLLPMPRYDPDGDSLGVPGRAKVSEEDARAQLDAYNA
QAWQRRIDLAYEASRTAARRMREAYWGDSQVPEDVELSDKMLEVPQRPALMSIVLSDFHAMVDKPSFAMSELPQF
LHKVGKGMPLDMKYGLLLPMHLTMGMGEVRVSLRDYPLPLLHIPSLKPGQSMRAQALTLKGNLVIGEEFQGVEST
RTVRVNVIPAGVRSSSFAIDVIRTVSAIKSYSDVYMDINTALPTRITWCPSYQPAIQDMMMVVESFTKPQLDPSE
QVGFWDKLRLNTHSHLHIAWKGDGDMHLSLKGTRDPYHVTGDGAGFLMCWRGDVRWNINVEEDPKRFMTVDSGEY
ILAIPDYSHLVRDAARAAGSRAGTGGDLVGGGIGVGLGLGLGIGLGAGAGAGAGGGAPGGIPIGGGGGSSVVVKS
GAVFKKVVMKLSGKVQWMAGLVFERAIVDGERNFHSKPHYEVVLKNPIYAKPDNDGLPYDAFRGFRSRHIHLSIG
VQAPADRKWSPDLPERSGSYNSVHLTPRVFTHFFEWWGLFSGPMSLPIRQGALFPGQEKNSKKFGRHLATVKYNL
LLAPLFLSHIYKHKEATAEEHADGAVSTTGLKVRFENFMLDLHQRREEFDAPGDKKEGKPSRITAIKVHECQLDL
ARADVRAVSASLRGKTTEAIRNGNLSPLMEDEKPDLSRFVIPDHDTSWIDMDDFVELDWILPTDPNPQTKILPLA
FSPRLTYFRQTDIDGTIAGDPTRKSPFGDEPTHYCYMTHDDDPKRVQARLIGQRLDQLEGQMLSHSRNVGEAELK
AVQTSSQDAQAMTDLEAMRRHTGDLKEKKAFLEKMLDQVTVTSSSSSSSSAEAGRSSEQNPDPDPGPRTAEFESD
YENRFVIHNMEFKWNNLLRNIVLRYIHQVSQRRGFVYYLSRPAVKFLLDIVEEQQQKHNKGNGERTASPTPSQRG
NTANGEAEMAASTGTASSTTGTSGAGAASSSAAAAATTTTTTTISAAAAAAAAASSSSSSSPPPAVTTATATATA
ATSIPHSERDAAQDLEERIRKMIHDGRVGHGSGSTICDLESGISRDYTPQHGYHVRLIAPQIQLQSERNKGNAVL
VTAKGMELKVVEVMDRERISDPVSGLVQRRMLLNMDSTQFFVARRGCFSSGTVAMYAGSRYGIPRGSIWPPWVPM
EAMFDFSADPIGFKRVMRKTSAMLRYDKFNNLRLKYGDEVETADGQKGQDEGRIQGHSQGHGQGQPLRPSSSSTW
SPPSSSHQADSGESLRSDSLWVDFPQVRALCNSSEYYAIYVIVLDLLMYSEPLEKTRSERLEKIMLASDFSDLSG
APLMVQRLQARIKQMEDIKSQFQVYGKHLDRRGWEDRLTLERDLAASEDELFFVMKAITTAQQKHETDKDTRALL
KWIISGRDIVWHLIRDSNEPLVELQLRDVEYDRTDNADGSHTNLVRVGKVLGLNLLPDATYPEMIGPYQQPGQHD
DGGRDMIRVYWHMLEAIAGITVMDRFEVSLYPTRLQLEREAGKLIFDYVFPGMGDGKNGGTAGSSSSSNNNNNNS
KAQEAGGHYHDKDNNNDDGRRGDDDDDDDDEDDDGMVGSLATARPGTIPPSAPTESGFSTRAGSLELRLRPTLAS
HAPHERASKKAWGGAVVSASGGHGDRDRTGSSGVNGAAANGSDGHGFRLFRSGTGRTMLAKKSSHDSLRSMGNPK
AGRSSSVKSSRDSSKGGGGVRFRGKADDKQQQQQHQQHQQQQQQQQQQQQQQQSDDLSKMLSRASNYMTFAYIRM
PSVVLCLSYRGKEHRNLEDVHDFVFRMPTMEWQNKTWSNLDLALALKKAVVKGLISHTGAIIGNKLSKRRPNAEQ
RMRLRELANSSVVISSNSSVNQIGDESSSDGSEEEEEEEEDGDDDDGGGDAEAAAAAGSVAV*
Coding >Ophcf2|05982
ATGTATTGCCCTCGCCAGCATCCCAACCTAGCTCATCGCATCGAAATAGCTCTTGTCGGTCCCTTTGCCCTCGGA
GCCGCCGCCATGGCTCTGCTGAACCCGACTTTTCTGTTGGGTCTGACTGTGCTGCTCTACCTGTCGTCCTTTGTC
CTCTTCGCCGTCATTCGCATCGTCACGGGCGTCTCCATCCAGCGCATCGGTTATCTATCGCTCCGGCGCCTGGCC
TATACGCCTCGAGATGGCGTCGTCATTGAGATTCGCAGCCTCGGTCTCAACGTCCATCGGCCTACCTTTGCGCAA
CCGACCTGGGTCAGTCTGGCGCTCAATGAGCTGGTCGTGACTGTCGACGCGCGAGGTCAGAAGGCGTCCAAGGCT
GGCGGTCCCGGTGACGATGAAGACGATATCAGTACCGCCCCGTCGACGCCGGACCTGAAGCCGCGTCCTGACCGG
TCCGGTCGCGAAAACATCTGGTCCAAGGCGGCCAAGCTCAGGCAGGCCGTCAAACAGCTACACCATTACATCGGC
TGGCTTCGCTTGGTGGACGTGGTTGCGACCAATACGACGGTCAACATGGTGGGCGTGGGCCACGTTCAGCTCGGC
AGCCTGACGGTAGCCGTCGACACGAGGCGCAAGATGGTCGGACGCTCGCGTATCTCGCGGAAGCTGAGCTCAGGC
GACGACGGCATCCGACAGGCTGAGTGGATCATGACGCTGCGAAGCCTCCTGTTCACGGCCGAGGGTGGCGAGTCG
CTCGAGGTGCTGGATCACGCCCTCTTCAACGTCCACGGCTCCCTGCACGAGACTCTAGGTGGCCTGCGCGACGTC
ACCATGGCACTGAAGCTGGGCAGCGTCAGCGTGCCGTACGACGACTTGGTGCTGTGCGCCGCCAAGATGCGGACG
CACCGGCAGCAGAAGGAGAAGGAGAAGGAGAAGGGGGAGGAGGATATAAACAAGAAGAAGCAAGACTTGGTGGGA
GGGAAGAAGCAGTCCAAGCCCGTGCCAGCGACGACAACGACGACGGCCGGTGAAACAGATGACGAGGACAAGAAC
GAGAAGCTGATGCAGACGGTGACGGACTCGCGCGAATTCTTCAGCGCCATCCTCCGAAACATCAAGGAGGTGCAG
TTCGCGGTCTCGTTCGCGGGCTTGACCAAGAAGATGACGTCCATCAAGGCGGCCACAAACCCGATGATCCTCACG
GCATCGATGAAGGAGGTGGGCATCGACTTTCACCGGCTCGATCCCAAGTCGCCAGCGCACCGCATGTACTTTTCG
CCCAAGGACATCGCGCACGAGGCTCTGGCGGCTGCCTTGTCCATCTCCATCGACCTCGACGACGGCCAGAGAGGC
CCCCAGCGTCTCTTTTACGTGCCAATGGCTACGACGACAGCCCGGACGACGCTGCCATCCAAGACGGTGCAGCTG
GCTCACGAGAGCGCCCTCGAGGAGCGCAACGCCAACATTCTCTTCGCCAACTCGGTGGTGACGTCGCCATCGGTC
GACCTCGATCCCGTCCATCTGCCACTACTCATCGCTCTTCTCCGACCCAAACCGAAGCCGGCGGCGGCGCAACAC
GGGCCCCGACAGCAGCTCATCTCGCGGCTACTCCCAAAGGCCAGCCTCAAGCTGTCGATGCACGAACCCGTGGTG
CGCATCCGGCTGAAGCCGCTGCAGCCGACGACCGACGCCGACGACTTTGACCTCATCATCTCGTCCATCTCGTCC
GTCTCCCTCGACGTAGAGTCGTCACACTCTCCCGTCGAGGACCTACACTACTTCCTCGACGGCTCGCTACGCCTA
CAGTCGCACCGGCTATACTACCAAACGAGCTCCGGCGACGTCTTTGACCTGATGACGACGGACTCGCTCGACGTC
AAGACACACCTGGCCGCGACGCCCGACGTCTGCGTCGACATGACGGGCGGTGTCCAGTCCTTCTCCGTCAGCATG
GCGCGTCAGGAGATCACCGACGGGCTGCGACAGATTGTGCGCCAGCTTCACGTCGACTCCGACCAGGAAAAGGCC
ATGACGACGGTTCGCGATGGGAAGACGGCACCGCGTCGTCGACACAACTTCTTACGAGCCGTGCCCGAGTGGCTG
ACGAGTTACCACTTTGAGGCTACAGACTTCAACGTGGAAGTGGCTGGCGTCGACGAGGACATTGCCGACGAGATG
CGCGGCGTCTCGCTCCATCTCGACTCCTTCTCGGCCGAATACCGCGCTCACAAGCTGGACGAGCCACAACGACGG
TTGACACGGCGTCGGGCGCATAGCCGGCTGGTCAGTAACCAGTCCGATTCGGACGTGGCGACGCCTCGTAAGAAG
CCTCAGACGGCCGGCGACGGACGCCGCCTTGTCCTTCAAGCCCGTGGCCTAGAGGCTCATATGGTCGAGGCTGTC
GATCAGCTCGAGATTGAGCCGTTCGTGCGGCTTCCGCGCCTGGAGCTCGTCCTATCCGCCGTCAGCGACGGACTC
GGCCCCATGTTCCATATCCAGGCCACGGTTCGAACCATACTGCTGCAGTACTCGCTGTATCGTCACTACGCCGTC
GGCGTGGCCGTCTTGACGCTGCGCAAGGCTCTGATGCGAACCGAACGCGACGTCGCTCCGAAGCCGCGCCCATCA
TGCTCGGAAACACGGCCGTTGCCGGCCGCCAGCGCGCCGCCCGGAACTACGGAGCTCGTCACCGTCGACGTCCGG
GCCTCGCTGGTGCAGGTCAAGGCCAACATGCCTCACGAGCCGGCCATGATGCTTCACGTATACGGGATCGAGGCC
GGCCGCCACCGCTGGTCGACGCCTTATCTGGCCACCAAGTTGGTTCGGCTCTTTGTCGAGCCGCCGAGGATGCGC
AACGTCTGGGCCCGGGTGCTCAGCGTCCACGCCGGTCGTGTCGACCTCCGCGAGTCCCGGCACAAGACGACCATG
GGCGGCTATTCCGAGGAGAAGATGCTCGACGTGGTGACCGAGGCAGTCCGGCTCGCGGTGCCTCACGAGGTCATC
GTCGACCACATCATCGACAACGTCATCAACACGGCCAAGGCTGTCCAGCAGCTACATCACCGCTTCCATACCGGC
ACCGACGAGTTCGTCGTGGAAAAGAAGCCCGAGTCGGCCAAGCTGCTTCCCAAGACTTCGATCCGGTCTCGCAAC
GTGCTGCTCGAGCTCGAGGACGGCGCGTTTGAGTGGAAGCTCGGCATCATCTATCGCACCGGTCGAGCCGAGCAG
GTGCAGCGCCTGGTCCGTGACGAGGCCTTCAGCCTCAAGGTTGCCAAGGTGCGCGACGAGGCTTCGGGCCGGGGC
AGCAAGGGCCGGTCGCGCTCCGTCATGTCCCGGGGCCGGGGGGCGGGAACATTGGCATCGGCGACGACATGGACA
CCGGCCCAGACGGGCGCCTGGTTCCGGAGCCGAAGCCTGGACCGGGGCCGGACGGCGACACCCACGGCGGCGACC
AGTTCTTCGACGACGACGACGACGACGACGACGACGGCGCCCCTGTTGCCGATGCCGCGCTACGACCCGGACGGA
GACAGTCTCGGCGTGCCCGGACGGGCCAAGGTGTCGGAGGAAGATGCCCGGGCGCAGCTGGACGCTTACAACGCG
CAGGCGTGGCAGAGGCGCATCGATCTCGCCTACGAGGCCTCGAGGACGGCGGCCAGGCGGATGCGCGAGGCCTAC
TGGGGCGACAGTCAGGTGCCCGAGGACGTCGAGCTGTCGGACAAGATGCTCGAGGTGCCGCAGCGGCCGGCCCTC
ATGTCCATCGTGCTGTCCGACTTCCATGCCATGGTGGACAAGCCGAGCTTCGCCATGAGCGAGCTGCCCCAGTTC
CTGCACAAGGTGGGCAAGGGCATGCCGCTGGATATGAAGTACGGCCTGCTGCTGCCGATGCACCTGACGATGGGC
ATGGGCGAGGTGCGCGTCTCGCTGCGCGACTATCCGCTGCCTCTGCTGCACATACCAAGCCTCAAGCCGGGCCAG
TCGATGCGGGCGCAGGCGCTGACGCTCAAGGGCAACCTGGTGATAGGCGAGGAGTTCCAGGGCGTCGAGTCGACG
CGGACGGTGCGCGTCAACGTGATACCGGCAGGGGTCAGGTCTTCGAGCTTCGCCATAGACGTGATACGGACCGTC
TCGGCCATCAAGTCGTACTCGGACGTCTACATGGACATCAACACGGCTCTACCGACGCGCATCACCTGGTGCCCG
TCGTACCAGCCGGCCATTCAGGACATGATGATGGTCGTCGAGTCCTTCACCAAGCCCCAGCTCGATCCGTCCGAG
CAGGTCGGCTTCTGGGACAAGCTCCGGCTCAATACGCACTCTCACCTGCACATTGCCTGGAAGGGCGACGGAGAC
ATGCATCTTTCGCTCAAGGGGACGCGCGATCCGTATCACGTCACGGGCGACGGCGCCGGCTTCCTCATGTGCTGG
AGAGGGGACGTCCGCTGGAACATCAACGTCGAGGAGGATCCGAAGCGCTTCATGACGGTCGACAGCGGCGAGTAC
ATCCTGGCCATTCCGGACTACAGCCATCTGGTTCGTGACGCGGCCCGCGCGGCGGGGAGCAGGGCGGGGACCGGC
GGGGATCTCGTCGGCGGCGGCATCGGTGTCGGGCTCGGGCTCGGGCTCGGGATCGGACTCGGAGCCGGAGCCGGA
GCCGGAGCCGGGGGTGGGGCTCCGGGAGGCATTCCCATCGGCGGCGGAGGCGGCAGCAGCGTCGTGGTCAAATCC
GGAGCCGTCTTCAAAAAGGTGGTGATGAAGCTGTCCGGAAAGGTGCAGTGGATGGCCGGTCTCGTCTTCGAGCGG
GCAATCGTCGACGGGGAGCGCAACTTTCACTCCAAGCCGCACTACGAGGTGGTGCTCAAGAACCCCATCTACGCC
AAGCCCGACAACGACGGGCTTCCATACGACGCCTTCCGAGGCTTCCGGAGCCGGCACATCCATCTCTCCATCGGC
GTCCAGGCCCCGGCCGACCGGAAGTGGTCGCCGGATCTGCCGGAGCGGTCCGGCAGCTACAACTCGGTCCACCTC
ACGCCGCGCGTCTTCACACACTTCTTCGAATGGTGGGGACTCTTCAGCGGGCCCATGTCGCTGCCCATCCGTCAG
GGCGCCCTGTTCCCGGGTCAGGAGAAGAACAGCAAGAAGTTCGGCCGGCATCTGGCGACGGTCAAGTACAACCTG
CTGCTGGCGCCCCTATTCCTCAGCCACATCTACAAGCACAAGGAGGCGACGGCCGAGGAGCACGCCGATGGAGCG
GTGTCGACGACGGGGCTCAAGGTGCGGTTCGAGAACTTCATGCTCGACCTGCACCAGCGACGCGAGGAGTTTGAC
GCGCCGGGAGATAAGAAGGAGGGCAAGCCCAGTCGGATCACGGCCATCAAGGTGCACGAGTGTCAGCTGGACCTG
GCCAGGGCCGACGTCAGGGCCGTTTCGGCCAGTCTCAGGGGAAAGACGACCGAGGCCATCCGCAACGGCAACCTG
TCGCCGCTGATGGAGGACGAGAAGCCGGATCTCTCGCGCTTCGTGATACCGGATCACGACACGAGCTGGATCGAC
ATGGACGACTTTGTCGAGCTCGATTGGATCCTCCCTACGGATCCGAACCCGCAGACCAAGATCCTGCCGCTGGCC
TTTTCACCGCGACTGACGTACTTTCGGCAGACGGACATTGACGGAACCATCGCCGGCGATCCGACGCGGAAGAGC
CCGTTCGGCGACGAGCCGACACATTACTGCTACATGACGCACGACGACGACCCCAAACGCGTGCAGGCGCGTCTG
ATCGGACAGAGGCTGGATCAGTTGGAGGGTCAGATGCTGTCGCACTCGCGCAACGTGGGCGAGGCGGAGCTCAAG
GCGGTGCAGACGAGCTCTCAGGACGCCCAGGCCATGACGGATCTCGAGGCCATGAGGCGTCATACGGGCGATCTC
AAGGAGAAGAAGGCCTTTCTGGAGAAGATGTTGGACCAGGTGACGGTGACGTCGTCGTCGTCGTCGTCGTCGTCG
GCTGAGGCGGGCCGGAGCTCGGAGCAGAACCCGGACCCGGACCCGGGGCCCCGCACGGCCGAGTTCGAGAGCGAC
TATGAGAACCGGTTCGTGATTCACAATATGGAATTCAAGTGGAACAACCTTTTGCGTAACATTGTTCTGCGGTAC
ATTCATCAGGTCAGCCAGCGGCGAGGTTTCGTCTACTATCTCTCGCGGCCGGCTGTCAAGTTCCTGCTCGACATC
GTCGAGGAGCAGCAGCAGAAGCACAACAAGGGCAACGGGGAAAGGACAGCATCGCCGACGCCCAGTCAGCGGGGG
AACACGGCCAACGGCGAGGCCGAGATGGCGGCCAGTACGGGGACGGCTAGCAGCACGACCGGGACATCTGGTGCC
GGTGCTGCTTCGTCTTCGGCCGCTGCTGCTGCTACTACTACTACTACTACTACTATCTCTGCTGCTGCTGCTGCT
GCTGCTGCTGCTTCTTCTTCTTCTTCTTCTTCTCCTCCTCCCGCCGTCACCACCGCTACCGCTACCGCTACTGCT
GCCACCTCGATCCCGCACTCGGAACGGGACGCGGCCCAGGACCTGGAAGAGCGGATCCGAAAGATGATTCACGAC
GGACGCGTCGGACACGGCTCCGGCTCGACCATATGCGATCTCGAGAGCGGCATCTCGCGCGACTACACGCCCCAG
CACGGCTACCACGTCCGGCTCATAGCGCCTCAGATCCAGCTGCAGAGCGAGCGAAACAAGGGCAACGCGGTGCTG
GTGACGGCCAAGGGCATGGAGCTCAAGGTGGTCGAGGTCATGGACCGGGAGCGCATCTCGGATCCGGTCAGCGGG
CTGGTGCAGCGCCGGATGCTGCTCAACATGGACAGCACGCAGTTCTTCGTGGCCCGACGCGGGTGCTTCTCGTCC
GGAACGGTGGCCATGTACGCCGGTAGCCGGTACGGGATACCCAGAGGGTCGATATGGCCGCCTTGGGTGCCGATG
GAGGCCATGTTTGACTTTTCCGCCGATCCCATCGGCTTCAAGCGGGTGATGAGGAAGACTTCGGCCATGCTGCGG
TACGACAAGTTCAATAACCTGCGGCTCAAGTACGGAGACGAGGTCGAGACGGCCGACGGGCAGAAGGGACAGGAC
GAGGGTCGGATTCAGGGGCACAGTCAGGGGCACGGTCAGGGGCAACCTCTACGGCCGTCGTCCTCGTCGACGTGG
TCACCACCGTCGTCTTCTCATCAGGCCGACTCGGGAGAGAGCCTCCGGTCAGACTCGCTCTGGGTCGACTTCCCA
CAGGTGCGGGCGCTCTGCAACTCGTCCGAGTACTACGCCATATACGTCATCGTCCTGGACCTCCTCATGTACAGC
GAGCCGCTGGAGAAGACGCGAAGCGAGCGGCTGGAGAAGATCATGCTGGCGTCGGACTTTAGCGACCTGAGCGGC
GCGCCCCTGATGGTGCAGCGGCTGCAGGCGCGCATCAAGCAGATGGAGGACATCAAGAGCCAGTTCCAGGTCTAC
GGCAAGCACCTGGATCGACGCGGATGGGAGGACCGTCTGACGCTGGAACGGGACCTGGCCGCGAGCGAGGACGAG
CTCTTCTTCGTCATGAAGGCCATCACGACGGCTCAGCAGAAGCACGAGACCGACAAGGACACCCGGGCTCTGCTC
AAGTGGATCATCTCGGGCCGAGACATTGTCTGGCACCTGATCCGCGACTCCAACGAGCCCCTGGTCGAGCTGCAG
CTGCGGGACGTCGAATACGACCGGACGGACAATGCCGACGGCTCGCATACCAACCTGGTGCGCGTCGGCAAGGTG
CTGGGGCTGAACCTGCTGCCGGACGCGACCTATCCCGAGATGATAGGGCCCTACCAGCAGCCGGGGCAGCACGAC
GACGGCGGACGGGACATGATTCGCGTCTACTGGCACATGCTCGAGGCCATCGCCGGCATCACCGTCATGGACCGC
TTCGAGGTCAGCCTGTATCCGACGAGGCTGCAGCTGGAGCGGGAGGCGGGCAAGCTGATCTTTGACTATGTCTTT
CCGGGCATGGGCGATGGGAAGAATGGCGGAACTGCCGGCAGCAGCAGCAGCAGCAACAACAACAACAACAACAGC
AAGGCTCAAGAGGCAGGAGGACACTACCATGACAAAGACAACAACAACGACGACGGCCGCCGCGGCGACGACGAC
GACGACGACGACGATGAAGACGACGACGGCATGGTCGGATCCTTGGCCACCGCCAGGCCCGGCACCATCCCCCCT
TCGGCCCCTACGGAATCGGGCTTTTCCACCCGTGCCGGCTCGCTCGAGTTGAGACTACGGCCGACGTTGGCCTCT
CACGCGCCGCACGAACGGGCGAGCAAAAAGGCATGGGGCGGGGCCGTCGTCTCGGCTTCGGGCGGACACGGAGAC
CGGGACAGGACGGGCAGCAGCGGCGTCAACGGGGCCGCGGCCAACGGCTCCGACGGCCACGGCTTCCGGCTCTTC
CGGAGCGGAACGGGAAGGACGATGCTGGCTAAGAAGTCTTCGCACGATTCGCTACGGAGCATGGGGAATCCCAAG
GCCGGACGGTCGTCGTCGGTCAAGTCTTCGCGTGACTCGTCCAAGGGAGGTGGTGGCGTGCGCTTCCGAGGCAAG
GCGGACGATAAGCAGCAGCAGCAGCAGCATCAACAGCATCAACAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAG
CAGCAGCAGTCGGACGATCTCAGCAAGATGCTCAGCCGGGCGAGCAACTACATGACGTTTGCCTACATCCGCATG
CCGTCGGTGGTGCTCTGTCTCAGCTACCGCGGCAAGGAGCATCGTAACCTGGAAGACGTGCACGACTTTGTCTTC
CGGATGCCGACGATGGAGTGGCAGAACAAGACGTGGTCTAACCTCGATCTCGCGCTGGCGCTGAAGAAGGCGGTC
GTCAAGGGGCTGATTTCGCATACGGGGGCCATTATCGGGAACAAGCTCTCCAAGAGGAGGCCCAACGCGGAGCAG
AGGATGAGGCTGCGAGAGCTGGCGAATAGCTCCGTCGTCATCTCCTCCAACTCTTCGGTGAATCAGATTGGGGAT
GAGAGCAGTTCCGACGGCAGCGAGGAGGAGGAGGAGGAGGAGGAGGACGGCGACGACGACGACGGTGGTGGAGAC
GCCGAAGCAGCAGCGGCGGCGGGATCCGTCGCGGTCTGA
Transcript >Ophcf2|05982
ATGTATTGCCCTCGCCAGCATCCCAACCTAGCTCATCGCATCGAAATAGCTCTTGTCGGTCCCTTTGCCCTCGGA
GCCGCCGCCATGGCTCTGCTGAACCCGACTTTTCTGTTGGGTCTGACTGTGCTGCTCTACCTGTCGTCCTTTGTC
CTCTTCGCCGTCATTCGCATCGTCACGGGCGTCTCCATCCAGCGCATCGGTTATCTATCGCTCCGGCGCCTGGCC
TATACGCCTCGAGATGGCGTCGTCATTGAGATTCGCAGCCTCGGTCTCAACGTCCATCGGCCTACCTTTGCGCAA
CCGACCTGGGTCAGTCTGGCGCTCAATGAGCTGGTCGTGACTGTCGACGCGCGAGGTCAGAAGGCGTCCAAGGCT
GGCGGTCCCGGTGACGATGAAGACGATATCAGTACCGCCCCGTCGACGCCGGACCTGAAGCCGCGTCCTGACCGG
TCCGGTCGCGAAAACATCTGGTCCAAGGCGGCCAAGCTCAGGCAGGCCGTCAAACAGCTACACCATTACATCGGC
TGGCTTCGCTTGGTGGACGTGGTTGCGACCAATACGACGGTCAACATGGTGGGCGTGGGCCACGTTCAGCTCGGC
AGCCTGACGGTAGCCGTCGACACGAGGCGCAAGATGGTCGGACGCTCGCGTATCTCGCGGAAGCTGAGCTCAGGC
GACGACGGCATCCGACAGGCTGAGTGGATCATGACGCTGCGAAGCCTCCTGTTCACGGCCGAGGGTGGCGAGTCG
CTCGAGGTGCTGGATCACGCCCTCTTCAACGTCCACGGCTCCCTGCACGAGACTCTAGGTGGCCTGCGCGACGTC
ACCATGGCACTGAAGCTGGGCAGCGTCAGCGTGCCGTACGACGACTTGGTGCTGTGCGCCGCCAAGATGCGGACG
CACCGGCAGCAGAAGGAGAAGGAGAAGGAGAAGGGGGAGGAGGATATAAACAAGAAGAAGCAAGACTTGGTGGGA
GGGAAGAAGCAGTCCAAGCCCGTGCCAGCGACGACAACGACGACGGCCGGTGAAACAGATGACGAGGACAAGAAC
GAGAAGCTGATGCAGACGGTGACGGACTCGCGCGAATTCTTCAGCGCCATCCTCCGAAACATCAAGGAGGTGCAG
TTCGCGGTCTCGTTCGCGGGCTTGACCAAGAAGATGACGTCCATCAAGGCGGCCACAAACCCGATGATCCTCACG
GCATCGATGAAGGAGGTGGGCATCGACTTTCACCGGCTCGATCCCAAGTCGCCAGCGCACCGCATGTACTTTTCG
CCCAAGGACATCGCGCACGAGGCTCTGGCGGCTGCCTTGTCCATCTCCATCGACCTCGACGACGGCCAGAGAGGC
CCCCAGCGTCTCTTTTACGTGCCAATGGCTACGACGACAGCCCGGACGACGCTGCCATCCAAGACGGTGCAGCTG
GCTCACGAGAGCGCCCTCGAGGAGCGCAACGCCAACATTCTCTTCGCCAACTCGGTGGTGACGTCGCCATCGGTC
GACCTCGATCCCGTCCATCTGCCACTACTCATCGCTCTTCTCCGACCCAAACCGAAGCCGGCGGCGGCGCAACAC
GGGCCCCGACAGCAGCTCATCTCGCGGCTACTCCCAAAGGCCAGCCTCAAGCTGTCGATGCACGAACCCGTGGTG
CGCATCCGGCTGAAGCCGCTGCAGCCGACGACCGACGCCGACGACTTTGACCTCATCATCTCGTCCATCTCGTCC
GTCTCCCTCGACGTAGAGTCGTCACACTCTCCCGTCGAGGACCTACACTACTTCCTCGACGGCTCGCTACGCCTA
CAGTCGCACCGGCTATACTACCAAACGAGCTCCGGCGACGTCTTTGACCTGATGACGACGGACTCGCTCGACGTC
AAGACACACCTGGCCGCGACGCCCGACGTCTGCGTCGACATGACGGGCGGTGTCCAGTCCTTCTCCGTCAGCATG
GCGCGTCAGGAGATCACCGACGGGCTGCGACAGATTGTGCGCCAGCTTCACGTCGACTCCGACCAGGAAAAGGCC
ATGACGACGGTTCGCGATGGGAAGACGGCACCGCGTCGTCGACACAACTTCTTACGAGCCGTGCCCGAGTGGCTG
ACGAGTTACCACTTTGAGGCTACAGACTTCAACGTGGAAGTGGCTGGCGTCGACGAGGACATTGCCGACGAGATG
CGCGGCGTCTCGCTCCATCTCGACTCCTTCTCGGCCGAATACCGCGCTCACAAGCTGGACGAGCCACAACGACGG
TTGACACGGCGTCGGGCGCATAGCCGGCTGGTCAGTAACCAGTCCGATTCGGACGTGGCGACGCCTCGTAAGAAG
CCTCAGACGGCCGGCGACGGACGCCGCCTTGTCCTTCAAGCCCGTGGCCTAGAGGCTCATATGGTCGAGGCTGTC
GATCAGCTCGAGATTGAGCCGTTCGTGCGGCTTCCGCGCCTGGAGCTCGTCCTATCCGCCGTCAGCGACGGACTC
GGCCCCATGTTCCATATCCAGGCCACGGTTCGAACCATACTGCTGCAGTACTCGCTGTATCGTCACTACGCCGTC
GGCGTGGCCGTCTTGACGCTGCGCAAGGCTCTGATGCGAACCGAACGCGACGTCGCTCCGAAGCCGCGCCCATCA
TGCTCGGAAACACGGCCGTTGCCGGCCGCCAGCGCGCCGCCCGGAACTACGGAGCTCGTCACCGTCGACGTCCGG
GCCTCGCTGGTGCAGGTCAAGGCCAACATGCCTCACGAGCCGGCCATGATGCTTCACGTATACGGGATCGAGGCC
GGCCGCCACCGCTGGTCGACGCCTTATCTGGCCACCAAGTTGGTTCGGCTCTTTGTCGAGCCGCCGAGGATGCGC
AACGTCTGGGCCCGGGTGCTCAGCGTCCACGCCGGTCGTGTCGACCTCCGCGAGTCCCGGCACAAGACGACCATG
GGCGGCTATTCCGAGGAGAAGATGCTCGACGTGGTGACCGAGGCAGTCCGGCTCGCGGTGCCTCACGAGGTCATC
GTCGACCACATCATCGACAACGTCATCAACACGGCCAAGGCTGTCCAGCAGCTACATCACCGCTTCCATACCGGC
ACCGACGAGTTCGTCGTGGAAAAGAAGCCCGAGTCGGCCAAGCTGCTTCCCAAGACTTCGATCCGGTCTCGCAAC
GTGCTGCTCGAGCTCGAGGACGGCGCGTTTGAGTGGAAGCTCGGCATCATCTATCGCACCGGTCGAGCCGAGCAG
GTGCAGCGCCTGGTCCGTGACGAGGCCTTCAGCCTCAAGGTTGCCAAGGTGCGCGACGAGGCTTCGGGCCGGGGC
AGCAAGGGCCGGTCGCGCTCCGTCATGTCCCGGGGCCGGGGGGCGGGAACATTGGCATCGGCGACGACATGGACA
CCGGCCCAGACGGGCGCCTGGTTCCGGAGCCGAAGCCTGGACCGGGGCCGGACGGCGACACCCACGGCGGCGACC
AGTTCTTCGACGACGACGACGACGACGACGACGACGGCGCCCCTGTTGCCGATGCCGCGCTACGACCCGGACGGA
GACAGTCTCGGCGTGCCCGGACGGGCCAAGGTGTCGGAGGAAGATGCCCGGGCGCAGCTGGACGCTTACAACGCG
CAGGCGTGGCAGAGGCGCATCGATCTCGCCTACGAGGCCTCGAGGACGGCGGCCAGGCGGATGCGCGAGGCCTAC
TGGGGCGACAGTCAGGTGCCCGAGGACGTCGAGCTGTCGGACAAGATGCTCGAGGTGCCGCAGCGGCCGGCCCTC
ATGTCCATCGTGCTGTCCGACTTCCATGCCATGGTGGACAAGCCGAGCTTCGCCATGAGCGAGCTGCCCCAGTTC
CTGCACAAGGTGGGCAAGGGCATGCCGCTGGATATGAAGTACGGCCTGCTGCTGCCGATGCACCTGACGATGGGC
ATGGGCGAGGTGCGCGTCTCGCTGCGCGACTATCCGCTGCCTCTGCTGCACATACCAAGCCTCAAGCCGGGCCAG
TCGATGCGGGCGCAGGCGCTGACGCTCAAGGGCAACCTGGTGATAGGCGAGGAGTTCCAGGGCGTCGAGTCGACG
CGGACGGTGCGCGTCAACGTGATACCGGCAGGGGTCAGGTCTTCGAGCTTCGCCATAGACGTGATACGGACCGTC
TCGGCCATCAAGTCGTACTCGGACGTCTACATGGACATCAACACGGCTCTACCGACGCGCATCACCTGGTGCCCG
TCGTACCAGCCGGCCATTCAGGACATGATGATGGTCGTCGAGTCCTTCACCAAGCCCCAGCTCGATCCGTCCGAG
CAGGTCGGCTTCTGGGACAAGCTCCGGCTCAATACGCACTCTCACCTGCACATTGCCTGGAAGGGCGACGGAGAC
ATGCATCTTTCGCTCAAGGGGACGCGCGATCCGTATCACGTCACGGGCGACGGCGCCGGCTTCCTCATGTGCTGG
AGAGGGGACGTCCGCTGGAACATCAACGTCGAGGAGGATCCGAAGCGCTTCATGACGGTCGACAGCGGCGAGTAC
ATCCTGGCCATTCCGGACTACAGCCATCTGGTTCGTGACGCGGCCCGCGCGGCGGGGAGCAGGGCGGGGACCGGC
GGGGATCTCGTCGGCGGCGGCATCGGTGTCGGGCTCGGGCTCGGGCTCGGGATCGGACTCGGAGCCGGAGCCGGA
GCCGGAGCCGGGGGTGGGGCTCCGGGAGGCATTCCCATCGGCGGCGGAGGCGGCAGCAGCGTCGTGGTCAAATCC
GGAGCCGTCTTCAAAAAGGTGGTGATGAAGCTGTCCGGAAAGGTGCAGTGGATGGCCGGTCTCGTCTTCGAGCGG
GCAATCGTCGACGGGGAGCGCAACTTTCACTCCAAGCCGCACTACGAGGTGGTGCTCAAGAACCCCATCTACGCC
AAGCCCGACAACGACGGGCTTCCATACGACGCCTTCCGAGGCTTCCGGAGCCGGCACATCCATCTCTCCATCGGC
GTCCAGGCCCCGGCCGACCGGAAGTGGTCGCCGGATCTGCCGGAGCGGTCCGGCAGCTACAACTCGGTCCACCTC
ACGCCGCGCGTCTTCACACACTTCTTCGAATGGTGGGGACTCTTCAGCGGGCCCATGTCGCTGCCCATCCGTCAG
GGCGCCCTGTTCCCGGGTCAGGAGAAGAACAGCAAGAAGTTCGGCCGGCATCTGGCGACGGTCAAGTACAACCTG
CTGCTGGCGCCCCTATTCCTCAGCCACATCTACAAGCACAAGGAGGCGACGGCCGAGGAGCACGCCGATGGAGCG
GTGTCGACGACGGGGCTCAAGGTGCGGTTCGAGAACTTCATGCTCGACCTGCACCAGCGACGCGAGGAGTTTGAC
GCGCCGGGAGATAAGAAGGAGGGCAAGCCCAGTCGGATCACGGCCATCAAGGTGCACGAGTGTCAGCTGGACCTG
GCCAGGGCCGACGTCAGGGCCGTTTCGGCCAGTCTCAGGGGAAAGACGACCGAGGCCATCCGCAACGGCAACCTG
TCGCCGCTGATGGAGGACGAGAAGCCGGATCTCTCGCGCTTCGTGATACCGGATCACGACACGAGCTGGATCGAC
ATGGACGACTTTGTCGAGCTCGATTGGATCCTCCCTACGGATCCGAACCCGCAGACCAAGATCCTGCCGCTGGCC
TTTTCACCGCGACTGACGTACTTTCGGCAGACGGACATTGACGGAACCATCGCCGGCGATCCGACGCGGAAGAGC
CCGTTCGGCGACGAGCCGACACATTACTGCTACATGACGCACGACGACGACCCCAAACGCGTGCAGGCGCGTCTG
ATCGGACAGAGGCTGGATCAGTTGGAGGGTCAGATGCTGTCGCACTCGCGCAACGTGGGCGAGGCGGAGCTCAAG
GCGGTGCAGACGAGCTCTCAGGACGCCCAGGCCATGACGGATCTCGAGGCCATGAGGCGTCATACGGGCGATCTC
AAGGAGAAGAAGGCCTTTCTGGAGAAGATGTTGGACCAGGTGACGGTGACGTCGTCGTCGTCGTCGTCGTCGTCG
GCTGAGGCGGGCCGGAGCTCGGAGCAGAACCCGGACCCGGACCCGGGGCCCCGCACGGCCGAGTTCGAGAGCGAC
TATGAGAACCGGTTCGTGATTCACAATATGGAATTCAAGTGGAACAACCTTTTGCGTAACATTGTTCTGCGGTAC
ATTCATCAGGTCAGCCAGCGGCGAGGTTTCGTCTACTATCTCTCGCGGCCGGCTGTCAAGTTCCTGCTCGACATC
GTCGAGGAGCAGCAGCAGAAGCACAACAAGGGCAACGGGGAAAGGACAGCATCGCCGACGCCCAGTCAGCGGGGG
AACACGGCCAACGGCGAGGCCGAGATGGCGGCCAGTACGGGGACGGCTAGCAGCACGACCGGGACATCTGGTGCC
GGTGCTGCTTCGTCTTCGGCCGCTGCTGCTGCTACTACTACTACTACTACTACTATCTCTGCTGCTGCTGCTGCT
GCTGCTGCTGCTTCTTCTTCTTCTTCTTCTTCTCCTCCTCCCGCCGTCACCACCGCTACCGCTACCGCTACTGCT
GCCACCTCGATCCCGCACTCGGAACGGGACGCGGCCCAGGACCTGGAAGAGCGGATCCGAAAGATGATTCACGAC
GGACGCGTCGGACACGGCTCCGGCTCGACCATATGCGATCTCGAGAGCGGCATCTCGCGCGACTACACGCCCCAG
CACGGCTACCACGTCCGGCTCATAGCGCCTCAGATCCAGCTGCAGAGCGAGCGAAACAAGGGCAACGCGGTGCTG
GTGACGGCCAAGGGCATGGAGCTCAAGGTGGTCGAGGTCATGGACCGGGAGCGCATCTCGGATCCGGTCAGCGGG
CTGGTGCAGCGCCGGATGCTGCTCAACATGGACAGCACGCAGTTCTTCGTGGCCCGACGCGGGTGCTTCTCGTCC
GGAACGGTGGCCATGTACGCCGGTAGCCGGTACGGGATACCCAGAGGGTCGATATGGCCGCCTTGGGTGCCGATG
GAGGCCATGTTTGACTTTTCCGCCGATCCCATCGGCTTCAAGCGGGTGATGAGGAAGACTTCGGCCATGCTGCGG
TACGACAAGTTCAATAACCTGCGGCTCAAGTACGGAGACGAGGTCGAGACGGCCGACGGGCAGAAGGGACAGGAC
GAGGGTCGGATTCAGGGGCACAGTCAGGGGCACGGTCAGGGGCAACCTCTACGGCCGTCGTCCTCGTCGACGTGG
TCACCACCGTCGTCTTCTCATCAGGCCGACTCGGGAGAGAGCCTCCGGTCAGACTCGCTCTGGGTCGACTTCCCA
CAGGTGCGGGCGCTCTGCAACTCGTCCGAGTACTACGCCATATACGTCATCGTCCTGGACCTCCTCATGTACAGC
GAGCCGCTGGAGAAGACGCGAAGCGAGCGGCTGGAGAAGATCATGCTGGCGTCGGACTTTAGCGACCTGAGCGGC
GCGCCCCTGATGGTGCAGCGGCTGCAGGCGCGCATCAAGCAGATGGAGGACATCAAGAGCCAGTTCCAGGTCTAC
GGCAAGCACCTGGATCGACGCGGATGGGAGGACCGTCTGACGCTGGAACGGGACCTGGCCGCGAGCGAGGACGAG
CTCTTCTTCGTCATGAAGGCCATCACGACGGCTCAGCAGAAGCACGAGACCGACAAGGACACCCGGGCTCTGCTC
AAGTGGATCATCTCGGGCCGAGACATTGTCTGGCACCTGATCCGCGACTCCAACGAGCCCCTGGTCGAGCTGCAG
CTGCGGGACGTCGAATACGACCGGACGGACAATGCCGACGGCTCGCATACCAACCTGGTGCGCGTCGGCAAGGTG
CTGGGGCTGAACCTGCTGCCGGACGCGACCTATCCCGAGATGATAGGGCCCTACCAGCAGCCGGGGCAGCACGAC
GACGGCGGACGGGACATGATTCGCGTCTACTGGCACATGCTCGAGGCCATCGCCGGCATCACCGTCATGGACCGC
TTCGAGGTCAGCCTGTATCCGACGAGGCTGCAGCTGGAGCGGGAGGCGGGCAAGCTGATCTTTGACTATGTCTTT
CCGGGCATGGGCGATGGGAAGAATGGCGGAACTGCCGGCAGCAGCAGCAGCAGCAACAACAACAACAACAACAGC
AAGGCTCAAGAGGCAGGAGGACACTACCATGACAAAGACAACAACAACGACGACGGCCGCCGCGGCGACGACGAC
GACGACGACGACGATGAAGACGACGACGGCATGGTCGGATCCTTGGCCACCGCCAGGCCCGGCACCATCCCCCCT
TCGGCCCCTACGGAATCGGGCTTTTCCACCCGTGCCGGCTCGCTCGAGTTGAGACTACGGCCGACGTTGGCCTCT
CACGCGCCGCACGAACGGGCGAGCAAAAAGGCATGGGGCGGGGCCGTCGTCTCGGCTTCGGGCGGACACGGAGAC
CGGGACAGGACGGGCAGCAGCGGCGTCAACGGGGCCGCGGCCAACGGCTCCGACGGCCACGGCTTCCGGCTCTTC
CGGAGCGGAACGGGAAGGACGATGCTGGCTAAGAAGTCTTCGCACGATTCGCTACGGAGCATGGGGAATCCCAAG
GCCGGACGGTCGTCGTCGGTCAAGTCTTCGCGTGACTCGTCCAAGGGAGGTGGTGGCGTGCGCTTCCGAGGCAAG
GCGGACGATAAGCAGCAGCAGCAGCAGCATCAACAGCATCAACAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAG
CAGCAGCAGTCGGACGATCTCAGCAAGATGCTCAGCCGGGCGAGCAACTACATGACGTTTGCCTACATCCGCATG
CCGTCGGTGGTGCTCTGTCTCAGCTACCGCGGCAAGGAGCATCGTAACCTGGAAGACGTGCACGACTTTGTCTTC
CGGATGCCGACGATGGAGTGGCAGAACAAGACGTGGTCTAACCTCGATCTCGCGCTGGCGCTGAAGAAGGCGGTC
GTCAAGGGGCTGATTTCGCATACGGGGGCCATTATCGGGAACAAGCTCTCCAAGAGGAGGCCCAACGCGGAGCAG
AGGATGAGGCTGCGAGAGCTGGCGAATAGCTCCGTCGTCATCTCCTCCAACTCTTCGGTGAATCAGATTGGGGAT
GAGAGCAGTTCCGACGGCAGCGAGGAGGAGGAGGAGGAGGAGGAGGACGGCGACGACGACGACGGTGGTGGAGAC
GCCGAAGCAGCAGCGGCGGCGGGATCCGTCGCGGTCTGA
Gene >Ophcf2|05982
ATGTATTGCCCTCGCCAGCATCCCAACCTAGGTAGGTACCTACCACCTAAGGCCAAGGCTCTTCTTCCACTCCAC
CCATCGTCATCGAGCCTCGCAACCTCGTCCCAGCCACGAACAGCAGACGGAGCGCCCCTCGGACCCTAATTTAAC
GGCCCGCTCTTCCAAGCTTCCCGCCGCTGGATAAAGCCGAGACTGCCGTCATGGGACTTGCGACGACGTCGTCTG
AAGCCATCTGCTCCCCGAGGCGATAGCTCATCGCATGTACGATCACTACACTTGATGCTGGCTCCCAGTTCCTCT
CACCCGCATGCTGATGCTGCTTAGCGAAATAGCTCTTGTCGGTCCCTTTGCCCTCGGAGCCGCCGCCATGGCTCT
GCTGAACCCGACTTTTCTGTTGGGTCTGACTGTGCTGCTCTACCTGTCGTCCTTTGTCCTCTTCGCCGTCATTCG
CATCGTCACGGGCGTCTCCATCCAGCGCATCGGTTATCTATCGCTCCGGCGCCTGGCCTATACGCCTCGAGATGG
CGTCGTCATTGAGATTCGCAGCCTCGGTCTCAACGTCCATCGGCCTACCTTTGCGCAACCGACCTGGGTCAGTCT
GGCGCTCAATGAGCTGGTCGTGACTGTCGACGCGCGAGGTCAGAAGGCGTCCAAGGCTGGCGGTCCCGGTGACGA
TGAAGACGATATCAGTACCGCCCCGTCGACGCCGGACCTGAAGCCGCGTCCTGACCGGTCCGGTCGCGAAAACAT
CTGGTCCAAGGCGGCCAAGCTCAGGCAGGCCGTCAAACAGCTACACCATTACATCGGCTGGCTTCGCTTGGTGGA
CGTGGTTGCGACCAATACGACGGTCAACATGGTGGGCGTGGGCCACGTTCAGCTCGGCAGCCTGACGGTAGCCGT
CGACACGAGGCGCAAGATGGTCGGACGCTCGCGTATCTCGCGGAAGCTGAGCTCAGGCGACGACGGCATCCGACA
GGCTGAGTGGATCATGACGCTGCGAAGCCTCCTGTTCACGGCCGAGGGTGGCGAGTCGCTCGAGGTGCTGGATCA
CGCCCTCTTCAACGTCCACGGCTCCCTGCACGAGACTCTAGGTGGCCTGCGCGACGTCACCATGGCACTGAAGCT
GGGCAGCGTCAGCGTGCCGTACGACGACTTGGTGCTGTGCGCCGCCAAGATGCGGACGCACCGGCAGCAGAAGGA
GAAGGAGAAGGAGAAGGGGGAGGAGGATATAAACAAGAAGAAGCAAGACTTGGTGGGAGGGAAGAAGCAGTCCAA
GCCCGTGCCAGCGACGACAACGACGACGGCCGGTGAAACAGATGACGAGGACAAGAACGAGAAGCTGATGCAGAC
GGTGACGGACTCGCGCGAATTCTTCAGCGCCATCCTCCGAAACATCAAGGAGGTGCAGTTCGCGGTCTCGTTCGC
GGGCTTGACCAAGAAGATGACGTCCATCAAGGCGGCCACAAACCCGATGATCCTCACGGCATCGATGAAGGAGGT
GGGCATCGACTTTCACCGGCTCGATCCCAAGTCGCCAGCGCACCGCATGTACTTTTCGCCCAAGGACATCGCGCA
CGAGGCTCTGGCGGCTGCCTTGTCCATCTCCATCGACCTCGACGACGGCCAGAGAGGCCCCCAGCGTCTCTTTTA
CGTGCCAATGGCTACGACGACAGCCCGGACGACGCTGCCATCCAAGACGGTGCAGCTGGCTCACGAGAGCGCCCT
CGAGGAGCGCAACGCCAACATTCTCTTCGCCAACTCGGTGGTGACGTCGCCATCGGTCGACCTCGATCCCGTCCA
TCTGCCACTACTCATCGCTCTTCTCCGACCCAAACCGAAGCCGGCGGCGGCGCAACACGGGCCCCGACAGCAGCT
CATCTCGCGGCTACTCCCAAAGGCCAGCCTCAAGCTGTCGATGCACGAACCCGTGGTGCGCATCCGGCTGAAGCC
GCTGCAGCCGACGACCGACGCCGACGACTTTGACCTCATCATCTCGTCCATCTCGTCCGTCTCCCTCGACGTAGA
GTCGTCACACTCTCCCGTCGAGGACCTACACTACTTCCTCGACGGCTCGCTACGCCTACAGTCGCACCGGCTATA
CTACCAAACGAGCTCCGGCGACGTCTTTGACCTGATGACGACGGACTCGCTCGACGTCAAGACACACCTGGCCGC
GACGCCCGACGTCTGCGTCGACATGACGGGCGGTGTCCAGTCCTTCTCCGTCAGCATGGCGCGTCAGGAGATCAC
CGACGGGCTGCGACAGATTGTGCGCCAGCTTCACGTCGACTCCGACCAGGAAAAGGCCATGACGACGGTTCGCGA
TGGGAAGACGGCACCGCGTCGTCGACACAACTTCTTACGAGCCGTGCCCGAGTGGCTGACGAGTTACCACTTTGA
GGCTACAGACTTCAACGTGGAAGTGGCTGGCGTCGACGAGGACATTGCCGACGAGATGCGCGGCGTCTCGCTCCA
TCTCGACTCCTTCTCGGCCGAATACCGCGCTCACAAGCTGGACGAGCCACAACGACGGTTGACACGGCGTCGGGC
GCATAGCCGGCTGGTCAGTAACCAGTCCGATTCGGACGTGGCGACGCCTCGTAAGAAGCCTCAGACGGCCGGCGA
CGGACGCCGCCTTGTCCTTCAAGCCCGTGGCCTAGAGGCTCATATGGTCGAGGCTGTCGATCAGCTCGAGATTGA
GCCGTTCGTGCGGCTTCCGCGCCTGGAGCTCGTCCTATCCGCCGTCAGCGACGGACTCGGCCCCATGTTCCATAT
CCAGGCCACGGTTCGAACCATACTGCTGCAGTACTCGCTGTATCGTCACTACGCCGTCGGCGTGGCCGTCTTGAC
GCTGCGCAAGGCTCTGATGCGAACCGAACGCGACGTCGCTCCGAAGCCGCGCCCATCATGCTCGGAAACACGGCC
GTTGCCGGCCGCCAGCGCGCCGCCCGGAACTACGGAGCTCGTCACCGTCGACGTCCGGGCCTCGCTGGTGCAGGT
CAAGGCCAACATGCCTCACGAGCCGGCCATGATGCTTCACGTATACGGGATCGAGGCCGGCCGCCACCGCTGGTC
GACGCCTTATCTGGCCACCAAGTTGGTTCGGCTCTTTGTCGAGCCGCCGAGGATGCGCAACGTCTGGGCCCGGGT
GCTCAGCGTCCACGCCGGTCGTGTCGACCTCCGCGAGTCCCGGCACAAGACGACCATGGGCGGCTATTCCGAGGA
GAAGATGCTCGACGTGGTGACCGAGGCAGTCCGGCTCGCGGTGCCTCACGAGGTCATCGTCGACCACATCATCGA
CAACGTCATCAACACGGCCAAGGCTGTCCAGCAGCTACATCACCGCTTCCATACCGGCACCGACGAGTTCGTCGT
GGAAAAGAAGCCCGAGTCGGCCAAGCTGCTTCCCAAGACTTCGATCCGGTCTCGCAACGTGCTGCTCGAGCTCGA
GGACGGCGCGTTTGAGTGGAAGCTCGGCATCATCTATCGCACCGGTCGAGCCGAGCAGGTGCAGCGCCTGGTCCG
TGACGAGGCCTTCAGCCTCAAGGTTGCCAAGGTGCGCGACGAGGCTTCGGGCCGGGGCAGCAAGGGCCGGTCGCG
CTCCGTCATGTCCCGGGGCCGGGGGGCGGGAACATTGGCATCGGCGACGACATGGACACCGGCCCAGACGGGCGC
CTGGTTCCGGAGCCGAAGCCTGGACCGGGGCCGGACGGCGACACCCACGGCGGCGACCAGTTCTTCGACGACGAC
GACGACGACGACGACGACGGCGCCCCTGTTGCCGATGCCGCGCTACGACCCGGACGGAGACAGTCTCGGCGTGCC
CGGACGGGCCAAGGTGTCGGAGGAAGATGCCCGGGCGCAGCTGGACGCTTACAACGCGCAGGCGTGGCAGAGGCG
CATCGATCTCGCCTACGAGGCCTCGAGGACGGCGGCCAGGCGGATGCGCGAGGCCTACTGGGGCGACAGTCAGGT
GCCCGAGGACGTCGAGCTGTCGGACAAGATGCTCGAGGTGCCGCAGCGGCCGGCCCTCATGTCCATCGTGCTGTC
CGACTTCCATGCCATGGTGGACAAGCCGAGCTTCGCCATGAGCGAGCTGCCCCAGTTCCTGCACAAGGTGGGCAA
GGGCATGCCGCTGGATATGAAGTACGGCCTGCTGCTGCCGATGCACCTGACGATGGGCATGGGCGAGGTGCGCGT
CTCGCTGCGCGACTATCCGCTGCCTCTGCTGCACATACCAAGCCTCAAGCCGGGCCAGTCGATGCGGGCGCAGGC
GCTGACGCTCAAGGGCAACCTGGTGATAGGCGAGGAGTTCCAGGGCGTCGAGTCGACGCGGACGGTGCGCGTCAA
CGTGATACCGGCAGGGGTCAGGTCTTCGAGCTTCGCCATAGACGTGATACGGACCGTCTCGGCCATCAAGTCGTA
CTCGGACGTCTACATGGACATCAACACGGCTCTACCGACGCGCATCACCTGGTGCCCGTCGTACCAGCCGGCCAT
TCAGGACATGATGATGGTCGTCGAGTCCTTCACCAAGCCCCAGCTCGATCCGTCCGAGCAGGTCGGCTTCTGGGA
CAAGCTCCGGCTCAATACGCACTCTCACCTGCACATTGCCTGGAAGGGCGACGGAGACATGCATCTTTCGCTCAA
GGGGACGCGCGATCCGTATCACGTCACGGGCGACGGCGCCGGCTTCCTCATGTGCTGGAGAGGGGACGTCCGCTG
GAACATCAACGTCGAGGAGGATCCGAAGCGCTTCATGACGGTCGACAGCGGCGAGTACATCCTGGCCATTCCGGA
CTACAGCCATCTGGTTCGTGACGCGGCCCGCGCGGCGGGGAGCAGGGCGGGGACCGGCGGGGATCTCGTCGGCGG
CGGCATCGGTGTCGGGCTCGGGCTCGGGCTCGGGATCGGACTCGGAGCCGGAGCCGGAGCCGGAGCCGGGGGTGG
GGCTCCGGGAGGCATTCCCATCGGCGGCGGAGGCGGCAGCAGCGTCGTGGTCAAATCCGGAGCCGTCTTCAAAAA
GGTGGTGATGAAGCTGTCCGGAAAGGTGCAGTGGATGGCCGGTCTCGTCTTCGAGCGGGCAATCGTCGACGGGGA
GCGCAACTTTCACTCCAAGCCGCACTACGAGGTGGTGCTCAAGAACCCCATCTACGCCAAGCCCGACAACGACGG
GCTTCCATACGACGCCTTCCGAGGCTTCCGGAGCCGGCACATCCATCTCTCCATCGGCGTCCAGGCCCCGGCCGA
CCGGAAGTGGTCGCCGGATCTGCCGGAGCGGTCCGGCAGCTACAACTCGGTCCACCTCACGCCGCGCGTCTTCAC
ACACTTCTTCGAATGGTGGGGACTCTTCAGCGGGCCCATGTCGCTGCCCATCCGTCAGGGCGCCCTGTTCCCGGG
TCAGGAGAAGAACAGCAAGAAGTTCGGCCGGCATCTGGCGACGGTCAAGTACAACCTGCTGCTGGCGCCCCTATT
CCTCAGCCACATCTACAAGCACAAGGAGGCGACGGCCGAGGAGCACGCCGATGGAGCGGTGTCGACGACGGGGCT
CAAGGTGCGGTTCGAGAACTTCATGCTCGACCTGCACCAGCGACGCGAGGAGTTTGACGCGCCGGGAGATAAGAA
GGAGGGCAAGCCCAGTCGGATCACGGCCATCAAGGTGCACGAGTGTCAGCTGGACCTGGCCAGGGCCGACGTCAG
GGCCGTTTCGGCCAGTCTCAGGGGAAAGACGACCGAGGCCATCCGCAACGGCAACCTGTCGCCGCTGATGGAGGA
CGAGAAGCCGGATCTCTCGCGCTTCGTGATACCGGATCACGACACGAGCTGGATCGACATGGACGACTTTGTCGA
GCTCGATTGGATCCTCCCTACGGATCCGAACCCGCAGACCAAGATCCTGCCGCTGGCCTTTTCACCGCGACTGAC
GTACTTTCGGCAGACGGACATTGACGGAACCATCGCCGGCGATCCGACGCGGAAGAGCCCGTTCGGCGACGAGCC
GACACATTACTGCTACATGACGCACGACGACGACCCCAAACGCGTGCAGGCGCGTCTGATCGGACAGAGGCTGGA
TCAGTTGGAGGGTCAGATGCTGTCGCACTCGCGCAACGTGGGCGAGGCGGAGCTCAAGGCGGTGCAGACGAGCTC
TCAGGACGCCCAGGCCATGACGGATCTCGAGGCCATGAGGCGTCATACGGGCGATCTCAAGGAGAAGAAGGCCTT
TCTGGAGAAGATGTTGGACCAGGTGACGGTGACGTCGTCGTCGTCGTCGTCGTCGTCGGCTGAGGCGGGCCGGAG
CTCGGAGCAGAACCCGGACCCGGACCCGGGGCCCCGCACGGCCGAGTTCGAGAGCGACTATGAGAACCGGTTCGT
GATTCACAATATGGAATTCAAGTGGAACAACCTTTTGCGTAACATTGTTCTGCGGTACATTCATCAGGTCAGCCA
GCGGCGAGGTTTCGTCTACTATCTCTCGCGGCCGGCTGTCAAGTTCCTGCTCGACATCGTCGAGGAGCAGCAGCA
GAAGCACAACAAGGGCAACGGGGAAAGGACAGCATCGCCGACGCCCAGTCAGCGGGGGAACACGGCCAACGGCGA
GGCCGAGATGGCGGCCAGTACGGGGACGGCTAGCAGCACGACCGGGACATCTGGTGCCGGTGCTGCTTCGTCTTC
GGCCGCTGCTGCTGCTACTACTACTACTACTACTACTATCTCTGCTGCTGCTGCTGCTGCTGCTGCTGCTTCTTC
TTCTTCTTCTTCTTCTCCTCCTCCCGCCGTCACCACCGCTACCGCTACCGCTACTGCTGCCACCTCGATCCCGCA
CTCGGAACGGGACGCGGCCCAGGACCTGGAAGAGCGGATCCGAAAGATGATTCACGACGGACGCGTCGGACACGG
CTCCGGCTCGACCATATGCGATCTCGAGAGCGGCATCTCGCGCGACTACACGCCCCAGCACGGCTACCACGTCCG
GCTCATAGCGCCTCAGATCCAGCTGCAGAGCGAGCGAAACAAGGGCAACGCGGTGCTGGTGACGGCCAAGGGCAT
GGAGCTCAAGGTGGTCGAGGTCATGGACCGGGAGCGCATCTCGGATCCGGTCAGCGGGCTGGTGCAGCGCCGGAT
GCTGCTCAACATGGACAGCACGCAGTTCTTCGTGGCCCGACGCGGGTGCTTCTCGTCCGGAACGGTGGCCATGTA
CGCCGGTAGCCGGTACGGGATACCCAGAGGGTCGATATGGCCGCCTTGGGTGCCGATGGAGGCCATGTTTGACTT
TTCCGCCGATCCCATCGGCTTCAAGCGGGTGATGAGGAAGACTTCGGCCATGCTGCGGTACGACAAGTTCAATAA
CCTGCGGCTCAAGTACGGAGACGAGGTCGAGACGGCCGACGGGCAGAAGGGACAGGACGAGGGTCGGATTCAGGG
GCACAGTCAGGGGCACGGTCAGGGGCAACCTCTACGGCCGTCGTCCTCGTCGACGTGGTCACCACCGTCGTCTTC
TCATCAGGCCGACTCGGGAGAGAGCCTCCGGTCAGACTCGCTCTGGGTCGACTTCCCACAGGTGCGGGCGCTCTG
CAACTCGTCCGAGTACTACGCCATATACGTCATCGTCCTGGACCTCCTCATGTACAGCGAGCCGCTGGAGAAGAC
GCGAAGCGAGCGGCTGGAGAAGATCATGCTGGCGTCGGACTTTAGCGACCTGAGCGGCGCGCCCCTGATGGTGCA
GCGGCTGCAGGCGCGCATCAAGCAGATGGAGGACATCAAGAGCCAGTTCCAGGTCTACGGCAAGCACCTGGATCG
ACGCGGATGGGAGGACCGTCTGACGCTGGAACGGGACCTGGCCGCGAGCGAGGACGAGCTCTTCTTCGTCATGAA
GGCCATCACGACGGCTCAGCAGAAGCACGAGACCGACAAGGACACCCGGGCTCTGCTCAAGTGGATCATCTCGGG
CCGAGACATTGTCTGGCACCTGATCCGCGACTCCAACGAGCCCCTGGTCGAGCTGCAGCTGCGGGACGTCGAATA
CGACCGGACGGACAATGCCGACGGCTCGCATACCAACCTGGTGCGCGTCGGCAAGGTGCTGGGGCTGAACCTGCT
GCCGGACGCGACCTATCCCGAGATGATAGGGCCCTACCAGCAGCCGGGGCAGCACGACGACGGCGGACGGGACAT
GATTCGCGTCTACTGGCACATGCTCGAGGCCATCGCCGGCATCACCGTCATGGACCGCTTCGAGGTCAGCCTGTA
TCCGACGAGGCTGCAGCTGGAGCGGGAGGCGGGCAAGCTGATCTTTGACTATGTCTTTCCGGGCATGGGCGATGG
GAAGAATGGCGGAACTGCCGGCAGCAGCAGCAGCAGCAACAACAACAACAACAACAGCAAGGCTCAAGAGGCAGG
AGGACACTACCATGACAAAGACAACAACAACGACGACGGCCGCCGCGGCGACGACGACGACGACGACGACGATGA
AGACGACGACGGCATGGTCGGATCCTTGGCCACCGCCAGGCCCGGCACCATCCCCCCTTCGGCCCCTACGGAATC
GGGCTTTTCCACCCGTGCCGGCTCGCTCGAGTTGAGACTACGGCCGACGTTGGCCTCTCACGCGCCGCACGAACG
GGCGAGCAAAAAGGCATGGGGCGGGGCCGTCGTCTCGGCTTCGGGCGGACACGGAGACCGGGACAGGACGGGCAG
CAGCGGCGTCAACGGGGCCGCGGCCAACGGCTCCGACGGCCACGGCTTCCGGCTCTTCCGGAGCGGAACGGGAAG
GACGATGCTGGCTAAGAAGTCTTCGCACGATTCGCTACGGAGCATGGGGAATCCCAAGGCCGGACGGTCGTCGTC
GGTCAAGTCTTCGCGTGACTCGTCCAAGGGAGGTGGTGGCGTGCGCTTCCGAGGCAAGGCGGACGATAAGCAGCA
GCAGCAGCAGCATCAACAGCATCAACAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGTCGGACGA
TCTCAGCAAGATGCTCAGCCGGGCGAGCAACTACATGACGTTTGCCTACATCCGCATGCCGTCGGTGGTGCTCTG
TCTCAGCTACCGCGGCAAGGAGCATCGTAACCTGGAAGACGTGCACGACTTTGTCTTCCGGATGCCGACGATGGA
GTGGCAGAACAAGACGTGGTCTAACCTCGATCTCGCGCTGGCGCTGAAGAAGGCGGTCGTCAAGGGGCTGATTTC
GCATACGGGGGCCATTATCGGGAACAAGCTCTCCAAGAGGAGGCCCAACGCGGAGCAGAGGATGAGGCTGCGAGA
GCTGGCGAATAGCTCCGTCGTCATCTCCTCCAACTCTTCGGTGAATCAGATTGGGGATGAGAGCAGTTCCGACGG
CAGCGAGGAGGAGGAGGAGGAGGAGGAGGACGGCGACGACGACGACGGTGGTGGTGAGAGGGGGCAGATGGCGAG
AGTCTGCGCCCGGCGAGTAAGAAACGGGGGCGGGGAGGACTCATGGCAGGAGACGCCGAAGCAGCAGCGGCGGCG
GGATCCGTCGCGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail