Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05974
Gene name
Locationscaffold_07:284441..286988
Strand-
Gene length (bp)2547
Transcript length (bp)2496
Coding sequence length (bp)2496
Protein length (aa) 832

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19343 DUF5923 Family of unknown function (DUF5923) 2.2E-244 3 612
PF14613 DUF4449 Protein of unknown function (DUF4449) 5.0E-65 624 786

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion 0.4313 0.1486 0.205 0.246 0.6805 0.0055 0.4774 0.4122 0.2422 0.2955

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2326
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3392
Ophiocordyceps australis map64 (Brazil) OphauB2|5783
Ophiocordyceps camponoti-floridani Ophcf2|05974 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7373
Ophiocordyceps kimflemingae Ophio5|3447
Ophiocordyceps subramaniannii Hirsu2|3159

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05974
MAANVNKPTDSKQKEADINRKLQLYGIFSAFQLGKVPSNDQIDVALNSFLASKALSEPDPKLSDDGKLLVKDTRE
MVERAQHLILSKNEGNLIQDFIWQTTQFDAKSIHGPDRPIDKDGLKRDGDETLKGLRTLGTLLITNGQFRKLLKD
ASVLLRDMAGDAASNAATFVRPSDDQLAQLDTAAPDNTWYDAPDLSKESLKKQAQNIYGGNAKKDAQDVAAAGNN
AAAPVGTSDPRAADRTAGQNAVVSAAKQKIDQNLDPETKEKIKKRNEEYRNKAKAYFEKKMPQERKEQIIFRLKK
MILECQQHQDYSEAIQTILRLAETYGRHGRSMGEGSAGSAKKARSGFAAAENDLRTLIERFANGTSTSELWASIH
KIYEAAEKDQDLKGWFKAMNNYIRRCLLEQGYILDEASTREWDRLYDHGRYLLRDKYRHQTDDVIGEVKFIADQF
DQDAHNKAFGKSVERIFDHLGHDSTGKSAFKPHLLKDLGEVILPTLLQNINYIPIPRIEYVDPQFEVAIENLVLE
SDNFMPNVFEVASENFFRWGRKNAGNKNHNMIDVKVSGIQMDLRDVSYYVRRKSGFPAISDLGVADILLPGNGLS
FRMQVSTADKSDRQNFFKVNKVDVDFKGLNIRLKQSRHKVLFALVKPLMLTILRPPIQKAVEKAIKDQCNKLDAE
MYQIKQEADRAAKDGQTDAEKQENFYKRYYQAAQKRFLEGKEKKKAEAKEVADDKKVNIAMTMEDSILPDVKLPG
GVSVKATEYKELARKGEKWESPVFSIGSAKKSTSVPLAPRIEKKTRPPPTPKATNVRPAVVNGKAPVANVNLPGQ
PQLGAY*
Coding >Ophcf2|05974
ATGGCTGCCAACGTCAACAAACCCACCGATTCCAAGCAGAAGGAGGCCGACATCAACCGCAAGCTCCAGCTCTAT
GGCATCTTCAGCGCCTTTCAGCTCGGCAAGGTGCCCTCGAACGATCAAATCGATGTCGCCCTCAACAGCTTCCTC
GCCTCCAAGGCCCTCAGTGAACCCGACCCCAAACTGTCCGACGATGGGAAGCTGCTCGTCAAGGACACGCGCGAG
ATGGTCGAAAGGGCCCAGCACCTGATCTTGTCCAAGAACGAGGGCAACCTGATTCAAGACTTCATCTGGCAAACT
ACCCAGTTTGACGCCAAGAGCATCCACGGCCCGGACCGTCCCATCGACAAGGATGGCCTCAAGCGCGATGGCGAC
GAGACGCTCAAGGGCCTGAGGACGCTCGGTACCCTGCTCATTACTAATGGCCAGTTCCGCAAGCTACTCAAGGAC
GCCTCCGTTCTCCTCCGCGACATGGCCGGAGACGCCGCCAGCAACGCCGCCACCTTTGTCCGTCCCTCCGACGAC
CAGCTCGCTCAGTTGGACACGGCCGCGCCCGACAACACCTGGTACGACGCCCCTGACCTCTCCAAGGAAAGCCTC
AAGAAGCAGGCCCAGAACATCTACGGTGGAAACGCCAAGAAGGACGCGCAGGACGTCGCCGCTGCTGGCAACAAT
GCCGCCGCCCCCGTCGGCACTTCTGACCCCCGGGCTGCCGACAGGACGGCCGGCCAGAACGCCGTCGTGTCCGCT
GCCAAGCAAAAGATTGATCAGAACCTCGATCCCGAGACCAAGGAGAAGATCAAGAAGCGCAACGAAGAGTACCGC
AACAAGGCAAAGGCCTACTTTGAGAAGAAGATGCCCCAGGAGCGCAAGGAACAGATCATCTTCCGTCTGAAGAAG
ATGATTCTCGAGTGCCAGCAACACCAGGACTACTCCGAGGCCATCCAGACGATCCTCAGGCTCGCCGAGACGTAC
GGCCGCCACGGTCGCTCCATGGGCGAGGGATCCGCAGGATCGGCAAAGAAGGCTCGTTCCGGCTTCGCCGCCGCC
GAGAACGATCTCCGCACCCTCATTGAGCGCTTCGCCAACGGCACCTCGACGTCGGAGCTCTGGGCCTCGATCCAC
AAGATCTACGAGGCTGCCGAAAAGGACCAGGATCTCAAGGGCTGGTTCAAGGCCATGAACAACTACATCCGCCGC
TGTCTGCTCGAGCAGGGCTACATCCTCGACGAGGCGTCGACGAGGGAGTGGGACCGCCTCTACGACCACGGCCGG
TACCTCCTCCGCGACAAATATCGTCACCAGACGGACGACGTCATTGGCGAGGTCAAGTTCATCGCCGACCAGTTC
GACCAGGACGCGCACAACAAGGCCTTTGGCAAGTCGGTCGAGCGCATCTTTGACCACTTGGGCCACGACTCGACT
GGCAAGTCGGCCTTTAAGCCCCATCTCCTCAAGGATCTCGGCGAGGTGATTCTGCCCACGTTGTTGCAGAACATC
AACTACATTCCCATCCCTCGTATCGAGTACGTGGATCCCCAGTTCGAGGTCGCCATTGAGAACCTGGTGCTGGAG
AGCGACAACTTCATGCCCAACGTCTTTGAGGTTGCCAGCGAGAACTTTTTTCGCTGGGGCCGCAAGAATGCCGGT
AACAAGAATCACAACATGATCGACGTCAAGGTCTCGGGCATTCAGATGGATCTTCGCGATGTCAGCTACTACGTC
AGGCGCAAGTCCGGCTTCCCAGCCATCAGCGACCTGGGCGTGGCCGACATCCTGCTGCCGGGCAACGGCCTGTCC
TTCCGCATGCAGGTGTCGACGGCCGACAAGTCGGACCGACAGAACTTCTTCAAGGTCAACAAGGTCGACGTCGAC
TTCAAGGGCCTCAACATCAGGCTCAAGCAGTCGCGCCACAAGGTGCTCTTCGCCCTCGTCAAGCCGCTGATGCTC
ACCATCCTGCGCCCGCCCATCCAGAAGGCGGTGGAGAAGGCCATCAAGGACCAGTGCAACAAGCTGGACGCCGAG
ATGTACCAGATCAAGCAGGAGGCCGACCGGGCCGCCAAGGATGGCCAGACGGACGCGGAGAAGCAGGAGAACTTT
TACAAGCGCTACTACCAGGCGGCGCAGAAGCGTTTCCTCGAGGGCAAGGAGAAGAAGAAGGCAGAGGCCAAGGAG
GTGGCCGATGACAAGAAGGTCAACATCGCCATGACGATGGAGGACAGCATCCTGCCGGATGTGAAGCTCCCGGGC
GGCGTGAGCGTCAAGGCGACCGAGTACAAGGAGCTGGCGCGCAAGGGCGAGAAGTGGGAGAGTCCCGTCTTCTCC
ATCGGTAGCGCCAAGAAGAGCACCAGCGTGCCTCTGGCGCCTCGCATCGAGAAGAAGACGCGACCGCCGCCGACG
CCCAAGGCGACTAATGTCCGCCCGGCCGTGGTCAACGGGAAGGCGCCGGTGGCCAATGTCAACCTGCCTGGACAG
CCTCAGCTCGGCGCCTACTAG
Transcript >Ophcf2|05974
ATGGCTGCCAACGTCAACAAACCCACCGATTCCAAGCAGAAGGAGGCCGACATCAACCGCAAGCTCCAGCTCTAT
GGCATCTTCAGCGCCTTTCAGCTCGGCAAGGTGCCCTCGAACGATCAAATCGATGTCGCCCTCAACAGCTTCCTC
GCCTCCAAGGCCCTCAGTGAACCCGACCCCAAACTGTCCGACGATGGGAAGCTGCTCGTCAAGGACACGCGCGAG
ATGGTCGAAAGGGCCCAGCACCTGATCTTGTCCAAGAACGAGGGCAACCTGATTCAAGACTTCATCTGGCAAACT
ACCCAGTTTGACGCCAAGAGCATCCACGGCCCGGACCGTCCCATCGACAAGGATGGCCTCAAGCGCGATGGCGAC
GAGACGCTCAAGGGCCTGAGGACGCTCGGTACCCTGCTCATTACTAATGGCCAGTTCCGCAAGCTACTCAAGGAC
GCCTCCGTTCTCCTCCGCGACATGGCCGGAGACGCCGCCAGCAACGCCGCCACCTTTGTCCGTCCCTCCGACGAC
CAGCTCGCTCAGTTGGACACGGCCGCGCCCGACAACACCTGGTACGACGCCCCTGACCTCTCCAAGGAAAGCCTC
AAGAAGCAGGCCCAGAACATCTACGGTGGAAACGCCAAGAAGGACGCGCAGGACGTCGCCGCTGCTGGCAACAAT
GCCGCCGCCCCCGTCGGCACTTCTGACCCCCGGGCTGCCGACAGGACGGCCGGCCAGAACGCCGTCGTGTCCGCT
GCCAAGCAAAAGATTGATCAGAACCTCGATCCCGAGACCAAGGAGAAGATCAAGAAGCGCAACGAAGAGTACCGC
AACAAGGCAAAGGCCTACTTTGAGAAGAAGATGCCCCAGGAGCGCAAGGAACAGATCATCTTCCGTCTGAAGAAG
ATGATTCTCGAGTGCCAGCAACACCAGGACTACTCCGAGGCCATCCAGACGATCCTCAGGCTCGCCGAGACGTAC
GGCCGCCACGGTCGCTCCATGGGCGAGGGATCCGCAGGATCGGCAAAGAAGGCTCGTTCCGGCTTCGCCGCCGCC
GAGAACGATCTCCGCACCCTCATTGAGCGCTTCGCCAACGGCACCTCGACGTCGGAGCTCTGGGCCTCGATCCAC
AAGATCTACGAGGCTGCCGAAAAGGACCAGGATCTCAAGGGCTGGTTCAAGGCCATGAACAACTACATCCGCCGC
TGTCTGCTCGAGCAGGGCTACATCCTCGACGAGGCGTCGACGAGGGAGTGGGACCGCCTCTACGACCACGGCCGG
TACCTCCTCCGCGACAAATATCGTCACCAGACGGACGACGTCATTGGCGAGGTCAAGTTCATCGCCGACCAGTTC
GACCAGGACGCGCACAACAAGGCCTTTGGCAAGTCGGTCGAGCGCATCTTTGACCACTTGGGCCACGACTCGACT
GGCAAGTCGGCCTTTAAGCCCCATCTCCTCAAGGATCTCGGCGAGGTGATTCTGCCCACGTTGTTGCAGAACATC
AACTACATTCCCATCCCTCGTATCGAGTACGTGGATCCCCAGTTCGAGGTCGCCATTGAGAACCTGGTGCTGGAG
AGCGACAACTTCATGCCCAACGTCTTTGAGGTTGCCAGCGAGAACTTTTTTCGCTGGGGCCGCAAGAATGCCGGT
AACAAGAATCACAACATGATCGACGTCAAGGTCTCGGGCATTCAGATGGATCTTCGCGATGTCAGCTACTACGTC
AGGCGCAAGTCCGGCTTCCCAGCCATCAGCGACCTGGGCGTGGCCGACATCCTGCTGCCGGGCAACGGCCTGTCC
TTCCGCATGCAGGTGTCGACGGCCGACAAGTCGGACCGACAGAACTTCTTCAAGGTCAACAAGGTCGACGTCGAC
TTCAAGGGCCTCAACATCAGGCTCAAGCAGTCGCGCCACAAGGTGCTCTTCGCCCTCGTCAAGCCGCTGATGCTC
ACCATCCTGCGCCCGCCCATCCAGAAGGCGGTGGAGAAGGCCATCAAGGACCAGTGCAACAAGCTGGACGCCGAG
ATGTACCAGATCAAGCAGGAGGCCGACCGGGCCGCCAAGGATGGCCAGACGGACGCGGAGAAGCAGGAGAACTTT
TACAAGCGCTACTACCAGGCGGCGCAGAAGCGTTTCCTCGAGGGCAAGGAGAAGAAGAAGGCAGAGGCCAAGGAG
GTGGCCGATGACAAGAAGGTCAACATCGCCATGACGATGGAGGACAGCATCCTGCCGGATGTGAAGCTCCCGGGC
GGCGTGAGCGTCAAGGCGACCGAGTACAAGGAGCTGGCGCGCAAGGGCGAGAAGTGGGAGAGTCCCGTCTTCTCC
ATCGGTAGCGCCAAGAAGAGCACCAGCGTGCCTCTGGCGCCTCGCATCGAGAAGAAGACGCGACCGCCGCCGACG
CCCAAGGCGACTAATGTCCGCCCGGCCGTGGTCAACGGGAAGGCGCCGGTGGCCAATGTCAACCTGCCTGGACAG
CCTCAGCTCGGCGCCTACTAG
Gene >Ophcf2|05974
ATGGCTGCCAACGTCAACAAACCCACCGATTCCAAGCAGAAGGAGGCCGACATCAACCGCAAGCTCCAGCTCTAT
GGCATCTTCAGCGCCTTTCAGCTCGGCAAGGTGCCCTCGGTGCGTCCACCCTCTCCTTGCCATCCTCTTTGTCTT
TGCTGACGATTGCAGAACGATCAAATCGATGTCGCCCTCAACAGCTTCCTCGCCTCCAAGGCCCTCAGTGAACCC
GACCCCAAACTGTCCGACGATGGGAAGCTGCTCGTCAAGGACACGCGCGAGATGGTCGAAAGGGCCCAGCACCTG
ATCTTGTCCAAGAACGAGGGCAACCTGATTCAAGACTTCATCTGGCAAACTACCCAGTTTGACGCCAAGAGCATC
CACGGCCCGGACCGTCCCATCGACAAGGATGGCCTCAAGCGCGATGGCGACGAGACGCTCAAGGGCCTGAGGACG
CTCGGTACCCTGCTCATTACTAATGGCCAGTTCCGCAAGCTACTCAAGGACGCCTCCGTTCTCCTCCGCGACATG
GCCGGAGACGCCGCCAGCAACGCCGCCACCTTTGTCCGTCCCTCCGACGACCAGCTCGCTCAGTTGGACACGGCC
GCGCCCGACAACACCTGGTACGACGCCCCTGACCTCTCCAAGGAAAGCCTCAAGAAGCAGGCCCAGAACATCTAC
GGTGGAAACGCCAAGAAGGACGCGCAGGACGTCGCCGCTGCTGGCAACAATGCCGCCGCCCCCGTCGGCACTTCT
GACCCCCGGGCTGCCGACAGGACGGCCGGCCAGAACGCCGTCGTGTCCGCTGCCAAGCAAAAGATTGATCAGAAC
CTCGATCCCGAGACCAAGGAGAAGATCAAGAAGCGCAACGAAGAGTACCGCAACAAGGCAAAGGCCTACTTTGAG
AAGAAGATGCCCCAGGAGCGCAAGGAACAGATCATCTTCCGTCTGAAGAAGATGATTCTCGAGTGCCAGCAACAC
CAGGACTACTCCGAGGCCATCCAGACGATCCTCAGGCTCGCCGAGACGTACGGCCGCCACGGTCGCTCCATGGGC
GAGGGATCCGCAGGATCGGCAAAGAAGGCTCGTTCCGGCTTCGCCGCCGCCGAGAACGATCTCCGCACCCTCATT
GAGCGCTTCGCCAACGGCACCTCGACGTCGGAGCTCTGGGCCTCGATCCACAAGATCTACGAGGCTGCCGAAAAG
GACCAGGATCTCAAGGGCTGGTTCAAGGCCATGAACAACTACATCCGCCGCTGTCTGCTCGAGCAGGGCTACATC
CTCGACGAGGCGTCGACGAGGGAGTGGGACCGCCTCTACGACCACGGCCGGTACCTCCTCCGCGACAAATATCGT
CACCAGACGGACGACGTCATTGGCGAGGTCAAGTTCATCGCCGACCAGTTCGACCAGGACGCGCACAACAAGGCC
TTTGGCAAGTCGGTCGAGCGCATCTTTGACCACTTGGGCCACGACTCGACTGGCAAGTCGGCCTTTAAGCCCCAT
CTCCTCAAGGATCTCGGCGAGGTGATTCTGCCCACGTTGTTGCAGAACATCAACTACATTCCCATCCCTCGTATC
GAGTACGTGGATCCCCAGTTCGAGGTCGCCATTGAGAACCTGGTGCTGGAGAGCGACAACTTCATGCCCAACGTC
TTTGAGGTTGCCAGCGAGAACTTTTTTCGCTGGGGCCGCAAGAATGCCGGTAACAAGAATCACAACATGATCGAC
GTCAAGGTCTCGGGCATTCAGATGGATCTTCGCGATGTCAGCTACTACGTCAGGCGCAAGTCCGGCTTCCCAGCC
ATCAGCGACCTGGGCGTGGCCGACATCCTGCTGCCGGGCAACGGCCTGTCCTTCCGCATGCAGGTGTCGACGGCC
GACAAGTCGGACCGACAGAACTTCTTCAAGGTCAACAAGGTCGACGTCGACTTCAAGGGCCTCAACATCAGGCTC
AAGCAGTCGCGCCACAAGGTGCTCTTCGCCCTCGTCAAGCCGCTGATGCTCACCATCCTGCGCCCGCCCATCCAG
AAGGCGGTGGAGAAGGCCATCAAGGACCAGTGCAACAAGCTGGACGCCGAGATGTACCAGATCAAGCAGGAGGCC
GACCGGGCCGCCAAGGATGGCCAGACGGACGCGGAGAAGCAGGAGAACTTTTACAAGCGCTACTACCAGGCGGCG
CAGAAGCGTTTCCTCGAGGGCAAGGAGAAGAAGAAGGCAGAGGCCAAGGAGGTGGCCGATGACAAGAAGGTCAAC
ATCGCCATGACGATGGAGGACAGCATCCTGCCGGATGTGAAGCTCCCGGGCGGCGTGAGCGTCAAGGCGACCGAG
TACAAGGAGCTGGCGCGCAAGGGCGAGAAGTGGGAGAGTCCCGTCTTCTCCATCGGTAGCGCCAAGAAGAGCACC
AGCGTGCCTCTGGCGCCTCGCATCGAGAAGAAGACGCGACCGCCGCCGACGCCCAAGGCGACTAATGTCCGCCCG
GCCGTGGTCAACGGGAAGGCGCCGGTGGCCAATGTCAACCTGCCTGGACAGCCTCAGCTCGGCGCCTACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail