Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05960
Gene name
Locationscaffold_07:250587..253910
Strand-
Gene length (bp)3323
Transcript length (bp)2298
Coding sequence length (bp)2298
Protein length (aa) 766

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00120 Gln-synt_C Glutamine synthetase, catalytic domain 5.0E-53 505 760
PF04909 Amidohydro_2 Amidohydrolase 9.3E-11 248 377

GO

GO Term Description Terminal node
GO:0006807 nitrogen compound metabolic process Yes
GO:0004356 glutamate-ammonia ligase activity Yes
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016880 acid-ammonia (or amide) ligase activity No
GO:0016211 ammonia ligase activity No
GO:0016874 ligase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.5936 0.6994 0.0305 0.0201 0.1258 0.0575 0.1465 0.3303 0.1094 0.1386

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup703
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6782
Ophiocordyceps australis map64 (Brazil) OphauB2|403
Ophiocordyceps camponoti-floridani Ophcf2|05960 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7275
Ophiocordyceps kimflemingae Ophio5|150
Ophiocordyceps subramaniannii Hirsu2|1320

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05960
MNAHDKATLHHAIQTTPIIDNHAHPLLKQTHVSKQALLSIASEAQGEALTASKSSLPHLRAVNHLASKLGCEASW
EAVEAAIDEKRGRGYRDWIGVCLAGIACVLVDDGLDGGGDVEPYSFFDGFTAASARRIVRIEAVAAGLIEDACLK
HDSADKARLFFTKQLDRVIEEALDDDAVVAFKSVICYRTGLAISPSATDCDPETFTLIFTQRRQANSGTFTRVNH
VQINDYLVHRLAHLVSLHNPPKPIQFHTGLGDNDLTLTTASPSHLQPFIRLYPSVPMVLLHSGYPFVCEAGYLAA
MYANVYADIGEVFPFLGRDAQEGVLRQMLGLCPASKILWSTDGHWFPETYFLAVMQMREVFEGVLGDVLFNNSNQ
LYGLHLEMNKTSVSETPLTLNTDLDSFLQLGSSLRFLRVCWLDMTSTARLRSIPTAQVMTQLRSDSRLTVGMTQA
ALGMTQNDGIVPGVSVVGEWHLRADFSSLRLGPRHGQATVMGDFIDHDGSEVVFCPRTLLRKAVATFQSRHVSFS
LGFEIELVLLNKVGDGLEICSDGGHAWATARPMDGEAAVTVIEEAVERLALAGVSVEMIHAESAPGQYEVVLPRA
PPLQAVDTLLLARSIISCCADAAGYRATLHPKPIPDGCGSASHVHLSMTSQAYESFYAGVLTHLRAICAFTLSSP
VSYDRVRQGTFAGGTWVAWGTQNRETALRKIKGSHWEVKCMDGLANPYLAISAILFAGWLGLEGGYELSWGDCTR
EPHLLSRSEREALGI*
Coding >Ophcf2|05960
ATGAACGCCCACGACAAAGCAACCCTCCACCATGCCATCCAGACAACGCCCATCATCGACAACCACGCCCACCCC
CTCCTCAAACAAACCCACGTCAGCAAACAAGCCCTCCTCTCCATCGCCAGCGAAGCCCAAGGCGAAGCCCTAACC
GCCAGCAAGTCTTCCCTCCCCCACCTCCGAGCCGTCAACCATCTCGCCAGCAAGCTCGGGTGCGAAGCATCGTGG
GAGGCGGTCGAGGCGGCCATTGACGAGAAGCGCGGCCGTGGATACCGTGATTGGATCGGCGTGTGTCTTGCTGGT
ATTGCCTGTGTGCTCGTTGATGATGGGTTGGATGGAGGGGGGGATGTTGAGCCGTATTCTTTCTTTGATGGCTTT
ACTGCCGCTTCTGCTAGGAGGATTGTTAGGATCGAGGCTGTGGCTGCGGGATTGATTGAGGATGCTTGTCTGAAG
CACGACTCTGCTGACAAGGCGAGACTCTTCTTCACGAAACAGCTGGATCGTGTCATTGAAGAGGCTCTGGATGAT
GATGCCGTCGTCGCCTTCAAGTCCGTCATCTGTTACCGAACCGGACTGGCGATATCCCCCTCGGCAACAGACTGC
GACCCCGAGACATTCACCCTCATCTTCACCCAACGAAGGCAAGCCAACTCGGGAACCTTTACCAGAGTCAACCAC
GTCCAGATAAACGACTATCTCGTCCACCGTCTCGCCCACCTCGTCTCCCTTCACAACCCCCCCAAGCCGATCCAG
TTCCACACCGGCCTCGGCGACAACGACCTAACCCTGACCACGGCATCTCCCTCCCACCTCCAGCCCTTCATCCGG
CTGTACCCCTCTGTGCCCATGGTGCTGCTTCACTCGGGATACCCCTTTGTCTGCGAGGCCGGATACCTGGCCGCC
ATGTACGCCAACGTCTACGCTGATATCGGAGAGGTGTTTCCCTTTCTGGGGAGGGATGCGCAGGAGGGGGTGCTG
CGGCAGATGCTGGGCTTGTGTCCCGCTTCCAAGATCCTCTGGAGTACGGATGGTCATTGGTTTCCCGAGACGTAT
TTCCTTGCGGTGATGCAGATGAGGGAGGTGTTTGAGGGGGTGTTGGGGGACGTGCTGTTCAACAACTCGAATCAG
CTTTACGGACTCCATCTCGAGATGAACAAGACGTCCGTCTCTGAAACTCCCTTGACTCTCAACACAGACTTGGAC
AGTTTCCTTCAACTAGGAAGCTCGCTTCGATTCCTCCGCGTATGCTGGCTCGACATGACATCAACCGCCCGCCTC
CGCTCCATCCCAACCGCCCAAGTCATGACCCAGCTGCGATCCGACTCTCGCCTGACCGTGGGCATGACGCAAGCC
GCCCTGGGCATGACCCAAAACGACGGCATCGTCCCGGGCGTCAGCGTCGTGGGAGAATGGCACCTACGAGCCGAC
TTCTCCAGCCTCCGTCTCGGTCCTCGCCACGGTCAGGCTACCGTCATGGGGGACTTCATCGACCACGATGGATCC
GAGGTGGTTTTCTGTCCGCGGACGCTGCTTCGGAAGGCGGTGGCTACCTTTCAGTCTCGTCATGTCTCCTTTTCG
CTCGGCTTTGAGATTGAGCTCGTCCTCTTGAACAAGGTTGGCGATGGACTCGAGATTTGTTCCGATGGGGGTCAT
GCTTGGGCTACGGCTCGGCCTATGGATGGTGAGGCAGCCGTGACGGTCATCGAGGAGGCTGTCGAGAGACTGGCC
CTTGCAGGCGTCTCGGTGGAAATGATTCACGCTGAAAGTGCTCCTGGTCAGTACGAGGTCGTTCTTCCACGGGCA
CCTCCTCTTCAAGCCGTGGATACGCTCCTCTTGGCCCGAAGCATCATCTCTTGCTGCGCCGATGCAGCTGGCTAT
CGAGCAACGCTACATCCTAAGCCGATCCCTGACGGATGCGGCTCAGCCAGCCATGTTCACCTCTCGATGACGAGT
CAAGCATACGAATCCTTCTACGCCGGTGTCCTCACTCATCTCAGAGCCATCTGTGCATTCACCCTCAGCAGTCCG
GTCAGCTACGACCGCGTCAGACAGGGCACCTTTGCCGGCGGAACGTGGGTAGCATGGGGAACGCAGAACCGCGAG
ACGGCCCTCCGAAAGATCAAGGGAAGCCACTGGGAAGTCAAGTGCATGGACGGCCTGGCGAATCCCTACCTCGCC
ATCTCCGCCATTCTCTTTGCTGGCTGGCTGGGCTTGGAAGGCGGGTATGAGCTCTCGTGGGGGGACTGCACCAGG
GAGCCTCATCTCCTGTCGAGATCCGAAAGGGAGGCTCTAGGTATTTAA
Transcript >Ophcf2|05960
ATGAACGCCCACGACAAAGCAACCCTCCACCATGCCATCCAGACAACGCCCATCATCGACAACCACGCCCACCCC
CTCCTCAAACAAACCCACGTCAGCAAACAAGCCCTCCTCTCCATCGCCAGCGAAGCCCAAGGCGAAGCCCTAACC
GCCAGCAAGTCTTCCCTCCCCCACCTCCGAGCCGTCAACCATCTCGCCAGCAAGCTCGGGTGCGAAGCATCGTGG
GAGGCGGTCGAGGCGGCCATTGACGAGAAGCGCGGCCGTGGATACCGTGATTGGATCGGCGTGTGTCTTGCTGGT
ATTGCCTGTGTGCTCGTTGATGATGGGTTGGATGGAGGGGGGGATGTTGAGCCGTATTCTTTCTTTGATGGCTTT
ACTGCCGCTTCTGCTAGGAGGATTGTTAGGATCGAGGCTGTGGCTGCGGGATTGATTGAGGATGCTTGTCTGAAG
CACGACTCTGCTGACAAGGCGAGACTCTTCTTCACGAAACAGCTGGATCGTGTCATTGAAGAGGCTCTGGATGAT
GATGCCGTCGTCGCCTTCAAGTCCGTCATCTGTTACCGAACCGGACTGGCGATATCCCCCTCGGCAACAGACTGC
GACCCCGAGACATTCACCCTCATCTTCACCCAACGAAGGCAAGCCAACTCGGGAACCTTTACCAGAGTCAACCAC
GTCCAGATAAACGACTATCTCGTCCACCGTCTCGCCCACCTCGTCTCCCTTCACAACCCCCCCAAGCCGATCCAG
TTCCACACCGGCCTCGGCGACAACGACCTAACCCTGACCACGGCATCTCCCTCCCACCTCCAGCCCTTCATCCGG
CTGTACCCCTCTGTGCCCATGGTGCTGCTTCACTCGGGATACCCCTTTGTCTGCGAGGCCGGATACCTGGCCGCC
ATGTACGCCAACGTCTACGCTGATATCGGAGAGGTGTTTCCCTTTCTGGGGAGGGATGCGCAGGAGGGGGTGCTG
CGGCAGATGCTGGGCTTGTGTCCCGCTTCCAAGATCCTCTGGAGTACGGATGGTCATTGGTTTCCCGAGACGTAT
TTCCTTGCGGTGATGCAGATGAGGGAGGTGTTTGAGGGGGTGTTGGGGGACGTGCTGTTCAACAACTCGAATCAG
CTTTACGGACTCCATCTCGAGATGAACAAGACGTCCGTCTCTGAAACTCCCTTGACTCTCAACACAGACTTGGAC
AGTTTCCTTCAACTAGGAAGCTCGCTTCGATTCCTCCGCGTATGCTGGCTCGACATGACATCAACCGCCCGCCTC
CGCTCCATCCCAACCGCCCAAGTCATGACCCAGCTGCGATCCGACTCTCGCCTGACCGTGGGCATGACGCAAGCC
GCCCTGGGCATGACCCAAAACGACGGCATCGTCCCGGGCGTCAGCGTCGTGGGAGAATGGCACCTACGAGCCGAC
TTCTCCAGCCTCCGTCTCGGTCCTCGCCACGGTCAGGCTACCGTCATGGGGGACTTCATCGACCACGATGGATCC
GAGGTGGTTTTCTGTCCGCGGACGCTGCTTCGGAAGGCGGTGGCTACCTTTCAGTCTCGTCATGTCTCCTTTTCG
CTCGGCTTTGAGATTGAGCTCGTCCTCTTGAACAAGGTTGGCGATGGACTCGAGATTTGTTCCGATGGGGGTCAT
GCTTGGGCTACGGCTCGGCCTATGGATGGTGAGGCAGCCGTGACGGTCATCGAGGAGGCTGTCGAGAGACTGGCC
CTTGCAGGCGTCTCGGTGGAAATGATTCACGCTGAAAGTGCTCCTGGTCAGTACGAGGTCGTTCTTCCACGGGCA
CCTCCTCTTCAAGCCGTGGATACGCTCCTCTTGGCCCGAAGCATCATCTCTTGCTGCGCCGATGCAGCTGGCTAT
CGAGCAACGCTACATCCTAAGCCGATCCCTGACGGATGCGGCTCAGCCAGCCATGTTCACCTCTCGATGACGAGT
CAAGCATACGAATCCTTCTACGCCGGTGTCCTCACTCATCTCAGAGCCATCTGTGCATTCACCCTCAGCAGTCCG
GTCAGCTACGACCGCGTCAGACAGGGCACCTTTGCCGGCGGAACGTGGGTAGCATGGGGAACGCAGAACCGCGAG
ACGGCCCTCCGAAAGATCAAGGGAAGCCACTGGGAAGTCAAGTGCATGGACGGCCTGGCGAATCCCTACCTCGCC
ATCTCCGCCATTCTCTTTGCTGGCTGGCTGGGCTTGGAAGGCGGGTATGAGCTCTCGTGGGGGGACTGCACCAGG
GAGCCTCATCTCCTGTCGAGATCCGAAAGGGAGGCTCTAGGTATTTAA
Gene >Ophcf2|05960
ATGAACGCCCACGACAAAGCAACCCTCCACCATGCCATCCAGACAACGCCCATCATCGACAACCACGCCCACCCC
CTCCTCAAACAAACCCACGTCAGCAAACAAGCCCTCCTCTCCATCGCCAGCGAAGCCCAAGGCGAAGCCCTAACC
GCCAGCAAGTCTTCCCTCCCCCACCTCCGAGCCGTCAACCATCTCGCCAGCAAGCTCGGGTGCGAAGCATCGTGG
GAGGCGGTCGAGGCGGCCATTGACGAGAAGCGCGGCCGTGGATACCGTGATTGGATCGGCGTGTGTCTTGCTGGT
ATTGCCTGTGTGCTCGTTGATGATGGGTTGGATGGAGGGGGGGATGTTGAGCCGTATTCTTTCTTTGATGGCTTT
ACTGCCGCTTCTGCTAGGAGGATTGTTAGGATCGAGGCTGTGGCTGCGGGATTGATTGAGGATGCTTGTCTGAAG
CACGACTCTGCTGACAAGGCGAGACTCTTCTTCACGAAACAGCTGGATCGTGTCATTGAAGAGGCTCTGGATGAT
GATGCCGTCGTCGCCTTCAAGTCCGTCATCTGTTACCGAACCGGACTGGCGATATCCCCCTCGGCAACAGACTGC
GACCCCGAGACATTCACCCTCATCTTCACCCAACGAAGGCAAGCCAACTCGGGAACCTTTACCAGAGTCAACCAC
GTCCAGATAAACGACTATCTCGTCCACCGTCTCGCCCACCTCGTCTCCCTTCACAACCCCCCCAAGCCGATCCAG
TTCCACACCGGCCTCGGCGACAACGACCTAACCCTGACCACGGCATCTCCCTCCCACCTCCAGCCCTTCATCCGG
CTGTACCCCTCTGTGCCCATGGTGCTGCTTCACTCGGGATACCCCTTTGTCTGCGAGGCCGGATACCTGGCCGCC
ATGTACGCCAACGTCTACGCTGATATCGGAGAGGTGTTTCCCTTTCTGGGGAGGGATGCGCAGGAGGGGGTGCTG
CGGCAGATGCTGGGCTTGTGTCCCGCTTCCAAGATCCTCTGGAGTACGGATGGTCATTGGTTTCCCGAGACGTAT
TTCCTTGCGGTGATGCAGATGAGGGAGGTGTTTGAGGGGGTGTTGGGGGGTTTGTGGGTAAGGGGGATTTGAGTC
TCGGACAGGCTGTTTGTCTCGTTGAAGACGTGCTGTTCAACAACTCGAATCAGCTTTACGGACTCCATCTCGAGA
TGAACAAGACGTCCGTCTCTGAAACTCCCTTGACTCTCAACACAGACTTGGACAGTTTCCTTCAACTAGGAAGCT
CGCTTCGATTCCTCCGCGTATGCTGGCTCGACATGACATCAACCGCCCGCCTCCGCTCCATCCCAACCGCCCAAG
TCATGACCCAGCTGCGATCCGACTCTCGCCTGACCGTGGGCATGACGCAAGCCGCCCTGGGCATGACCCAAAACG
ACGGCATCGTCCCGGGCGTCAGCGTCGTGGGAGAATGGCACCTACGAGCCGACTTCTCCAGCCTCCGTCTCGGTC
CTCGCCACGGTCAGGCTACCGTCATGGGGGACTTCATCGACCACGATGGATCCGAGGTGGTTTTCTGTCCGCGGA
CGCTGCTTCGGAAGGCGGTGGCTACCTTTCAGTCTCGTCATGTCTCCTTTTCGCTCGGCTTTGAGATTGAGCTCG
TCCTCTTGAACAAGGTTGGCGATGGACTCGAGATTTGTTCCGATGGGGGTCATGCTTGGGCTACGGCTCGGCCTA
TGGATGGTGAGGCAGCCGTGACGGTCATCGAGGAGGCTGTCGAGAGACTGGCCCTTGCAGGCGTCTCGGTGGAAA
TGATTCACGCTGAAAGTGCTCCTGGTCAGTACGAGGTCGTTCTTCCACGGGCACCTCCTCTTCAAGCCGTGGATA
CGCTCCTCTTGGCCCGAAGCATCATCTCTTGCTGCGCCGATGCAGCTGGCTATCGAGCAACGCTACATCCTAAGC
CGATCCCTGACGGATGCGGCTCAGCCAGCCATGTTCACCTCTCGATGACGAGTCAAGCATACGAATCCTTCTACG
CCGGTGTCCTCACTCATCTCAGAGCCATCTGTGCATTCACCCTCAGCAGTCCGGTCAGCTACGACCGCGTCAGAC
AGGGCACCTTTGCCGGCGGAACGTGGGTAGCATGGGGAACGCAGAACCGCGAGACGGCCCTCCGAAAGATCAAGG
GAAGCCACTGGGAAGTCAAGTGCATGGACGGCCTGGCGAATCCCTACCTCGCCATCTCCGCCATTCTCTTTGCTG
GCTGGCTGGGCTTGGAAGGCGGGTATGAGCTCTCGTGGGGGGACTGCACCAGGGAGCCTCATCTCCTGTCGAGAT
CCGAAAGGGAGGCTCTAGGTATTGTGAGCGGGTTGCCTGGGAGTCTGGGGGAGGCTCTTGATGAGCTAGAGGGGA
TGGGGAGTTGGGGGGGTTGCTCGGGGGCAGTTGGTGGAGAGGTATCTTGCCGTTAAGAGGGATGAGATGAAGAGC
TTTGCGGGTTTAGAGGAGGGGAAGAGATGGCGGTGGATCGTAGAGAGGTACTAGATTCTGCTGGATTGCATCAGG
GGTCGAATCATGGTGGATTTCGACCATGTCAATGTTGAGTCTGGTCATGTATGTGATGTCATGTACATAGAGTAA
TCCCCAAGGTTTCGAAGTGTTTGTACAAGAGACCATGACTCTTAGACTGTCTATCCTCTCGCGGATGGCAATGTA
TCTTTTGTTGTTTTTCATGTGGTGGCGAGAGCGTCACCGTACATACATGTAGCACGAGATGTACGGACAGCCTCC
TCGACAGAGTTTCTTCAAAGTTCCATCCCGCCGCCGATGACGATAGAGCCAAGGCATCTCGTCTTTCCATCCTAT
TTCAGCACAAGATCTCCCAAGACTGAAAAATGGAAGCTTTCAAGACAACATGGGGAACTGACCTCCTCCCCGTCT
CAGACACACGTACGACATGCTCGCCCCTTGTCTTTGCACACGCTACGCTCCCCGTCTGATCCTCTCTACGTCTAT
TACTACAGCCACGTCCGGTATTCCCTGAAATAAGCTTCCGTGCGCAGCTGCGGCATCTAAGCCGGCTCGGACCGG
CAAAACCCAAGCCTCAACGGGACAACGATAATTACATACATGTAGCAACGCACGAAATTAAATCACCTCGCACGT
CTGTCAAGTACGCGTCCAGCATGTTACAACCGGGTTACTGTAGTATGTATGTACATACACGTAATTGAAGATGCG
GACCCAGGACCATCTATCAATGTAAAGACGAGCCGGCACGGACTCGAAACTCGTGCTGCAACCACCATTCTTCCC
ATCCTTCTCCTTGCCGCTAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail