Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05955
Gene name
Locationscaffold_07:240264..241857
Strand-
Gene length (bp)1593
Transcript length (bp)1593
Coding sequence length (bp)1593
Protein length (aa) 531

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13002 LDB19 Arrestin_N terminal like 8.4E-34 153 317

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6137 0.3767 0.1806 0.2168 0.1047 0.0022 0.1588 0.3389 0.2969 0.0232

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4471
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7754
Ophiocordyceps australis map64 (Brazil) OphauB2|5787
Ophiocordyceps camponoti-floridani Ophcf2|05955 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7350
Ophiocordyceps kimflemingae Ophio5|3512
Ophiocordyceps subramaniannii Hirsu2|9310

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05955
MPHRVTNFLRTSSSSYHAQKKKTAPSPRSPASSCNSSRAASPSYTSDSDDQHHAVAMPDHITEALRKHHRLSLPF
GRRENRGHHGSNSTATSAVRLDWSIESPPIVFHGGPEESTGALVSGQMLMDVREDSVDVESFVATLGLQITQKRP
FQGHCCDCQRQTTELKAWRLLTKTATLRRGRHLFPFSALLEGRLPACLDSSMLVIEYVFKAEAMVLRSNGSSRAS
VRFGRTLDVKRSLPEPLYPHHSVRVFPPTNIKASAHYSSVIHPTGSNQLTLKLDGLTSRNVKAGTVDIWRLKKVT
WRLEETVKTYAPACRRHAPPSSTSSSSCSSSSSSSALTDDDDDDDDDDDVNTGEDSGDGDGDGSHTTSAHQKRVF
RVNTRTLGEKQLHDGWKSDFSGLDGTVDMEFNFGVPVAKTHSREPTYACDTKTRDGTDVSHSLLIELIVSKEYAP
DGKPHLATQTGTGRILRMHFAVVMTEFPGLGVSWDNESPPVYQDVPPSPPGYPFAPPIDYEELEVLDTRRPERRS
LEPSP*
Coding >Ophcf2|05955
ATGCCTCACCGCGTCACAAACTTCCTCCGTACATCGTCCTCGTCCTACCACGCCCAGAAGAAAAAGACGGCTCCC
TCACCCCGATCTCCGGCCTCGTCCTGCAACAGCTCGCGAGCCGCCAGCCCCTCATACACTTCCGACTCGGACGAT
CAACACCATGCCGTCGCCATGCCTGACCACATCACCGAGGCCTTGAGGAAGCATCACCGTCTGTCTCTGCCTTTT
GGCCGCAGGGAGAATCGTGGCCATCATGGCTCCAACTCGACGGCCACCTCGGCCGTCCGTCTCGACTGGAGCATC
GAGAGCCCGCCCATCGTGTTTCATGGCGGCCCGGAGGAGAGCACCGGTGCCCTCGTCTCGGGCCAGATGCTCATG
GACGTCAGAGAAGATAGCGTCGACGTCGAAAGCTTCGTCGCCACCCTGGGCCTCCAGATCACGCAGAAGAGACCC
TTCCAAGGTCATTGCTGTGACTGCCAACGCCAGACGACGGAGCTCAAGGCCTGGCGTCTACTGACCAAGACGGCC
ACGTTGCGCCGCGGTCGTCACCTGTTCCCCTTTTCCGCCCTCCTCGAAGGCCGTCTGCCCGCCTGTCTGGACTCG
TCCATGCTGGTCATCGAGTACGTCTTCAAGGCCGAGGCCATGGTGCTACGGTCCAACGGCTCGTCACGCGCCAGT
GTCCGCTTCGGTCGCACCCTCGATGTCAAGCGCTCGCTGCCCGAGCCCCTCTACCCGCACCACTCGGTCCGCGTC
TTCCCTCCCACGAATATAAAGGCCAGCGCCCACTACAGCTCCGTCATCCATCCGACCGGCTCCAATCAGCTCACG
CTCAAGCTCGACGGCCTCACGTCGCGCAACGTCAAGGCTGGCACCGTCGATATCTGGCGTCTCAAGAAGGTGACG
TGGCGACTCGAGGAGACGGTCAAGACGTACGCACCCGCCTGCCGACGTCACGCGCCTCCTTCCTCTACATCGTCG
TCGTCTTGCTCTTCCTCTTCCTCCTCTTCCGCCCTCACAGACGACGACGACGACGACGATGACGACGATGACGTC
AACACTGGCGAAGACAGTGGCGATGGCGACGGCGACGGCTCGCACACCACTTCGGCACACCAGAAGCGCGTCTTT
CGCGTCAACACGCGGACCCTAGGCGAGAAGCAGCTCCATGACGGCTGGAAGTCGGACTTTAGCGGCCTCGACGGC
ACCGTCGACATGGAGTTCAACTTTGGCGTCCCCGTCGCTAAAACGCACTCTCGCGAGCCGACGTACGCCTGTGAC
ACCAAGACACGCGACGGTACCGATGTGTCGCACTCGCTCCTCATCGAGCTCATCGTGTCCAAGGAGTATGCACCC
GACGGCAAGCCTCACCTGGCGACGCAGACGGGCACGGGCCGTATCCTGCGCATGCACTTTGCCGTCGTCATGACC
GAGTTCCCGGGCCTGGGCGTCAGCTGGGACAACGAGTCGCCCCCGGTCTATCAGGACGTGCCGCCCAGTCCGCCG
GGGTACCCCTTTGCGCCCCCAATCGACTACGAGGAGCTCGAGGTGCTCGACACTCGGCGGCCCGAGAGGAGAAGC
TTGGAACCGTCACCTTGA
Transcript >Ophcf2|05955
ATGCCTCACCGCGTCACAAACTTCCTCCGTACATCGTCCTCGTCCTACCACGCCCAGAAGAAAAAGACGGCTCCC
TCACCCCGATCTCCGGCCTCGTCCTGCAACAGCTCGCGAGCCGCCAGCCCCTCATACACTTCCGACTCGGACGAT
CAACACCATGCCGTCGCCATGCCTGACCACATCACCGAGGCCTTGAGGAAGCATCACCGTCTGTCTCTGCCTTTT
GGCCGCAGGGAGAATCGTGGCCATCATGGCTCCAACTCGACGGCCACCTCGGCCGTCCGTCTCGACTGGAGCATC
GAGAGCCCGCCCATCGTGTTTCATGGCGGCCCGGAGGAGAGCACCGGTGCCCTCGTCTCGGGCCAGATGCTCATG
GACGTCAGAGAAGATAGCGTCGACGTCGAAAGCTTCGTCGCCACCCTGGGCCTCCAGATCACGCAGAAGAGACCC
TTCCAAGGTCATTGCTGTGACTGCCAACGCCAGACGACGGAGCTCAAGGCCTGGCGTCTACTGACCAAGACGGCC
ACGTTGCGCCGCGGTCGTCACCTGTTCCCCTTTTCCGCCCTCCTCGAAGGCCGTCTGCCCGCCTGTCTGGACTCG
TCCATGCTGGTCATCGAGTACGTCTTCAAGGCCGAGGCCATGGTGCTACGGTCCAACGGCTCGTCACGCGCCAGT
GTCCGCTTCGGTCGCACCCTCGATGTCAAGCGCTCGCTGCCCGAGCCCCTCTACCCGCACCACTCGGTCCGCGTC
TTCCCTCCCACGAATATAAAGGCCAGCGCCCACTACAGCTCCGTCATCCATCCGACCGGCTCCAATCAGCTCACG
CTCAAGCTCGACGGCCTCACGTCGCGCAACGTCAAGGCTGGCACCGTCGATATCTGGCGTCTCAAGAAGGTGACG
TGGCGACTCGAGGAGACGGTCAAGACGTACGCACCCGCCTGCCGACGTCACGCGCCTCCTTCCTCTACATCGTCG
TCGTCTTGCTCTTCCTCTTCCTCCTCTTCCGCCCTCACAGACGACGACGACGACGACGATGACGACGATGACGTC
AACACTGGCGAAGACAGTGGCGATGGCGACGGCGACGGCTCGCACACCACTTCGGCACACCAGAAGCGCGTCTTT
CGCGTCAACACGCGGACCCTAGGCGAGAAGCAGCTCCATGACGGCTGGAAGTCGGACTTTAGCGGCCTCGACGGC
ACCGTCGACATGGAGTTCAACTTTGGCGTCCCCGTCGCTAAAACGCACTCTCGCGAGCCGACGTACGCCTGTGAC
ACCAAGACACGCGACGGTACCGATGTGTCGCACTCGCTCCTCATCGAGCTCATCGTGTCCAAGGAGTATGCACCC
GACGGCAAGCCTCACCTGGCGACGCAGACGGGCACGGGCCGTATCCTGCGCATGCACTTTGCCGTCGTCATGACC
GAGTTCCCGGGCCTGGGCGTCAGCTGGGACAACGAGTCGCCCCCGGTCTATCAGGACGTGCCGCCCAGTCCGCCG
GGGTACCCCTTTGCGCCCCCAATCGACTACGAGGAGCTCGAGGTGCTCGACACTCGGCGGCCCGAGAGGAGAAGC
TTGGAACCGTCACCTTGA
Gene >Ophcf2|05955
ATGCCTCACCGCGTCACAAACTTCCTCCGTACATCGTCCTCGTCCTACCACGCCCAGAAGAAAAAGACGGCTCCC
TCACCCCGATCTCCGGCCTCGTCCTGCAACAGCTCGCGAGCCGCCAGCCCCTCATACACTTCCGACTCGGACGAT
CAACACCATGCCGTCGCCATGCCTGACCACATCACCGAGGCCTTGAGGAAGCATCACCGTCTGTCTCTGCCTTTT
GGCCGCAGGGAGAATCGTGGCCATCATGGCTCCAACTCGACGGCCACCTCGGCCGTCCGTCTCGACTGGAGCATC
GAGAGCCCGCCCATCGTGTTTCATGGCGGCCCGGAGGAGAGCACCGGTGCCCTCGTCTCGGGCCAGATGCTCATG
GACGTCAGAGAAGATAGCGTCGACGTCGAAAGCTTCGTCGCCACCCTGGGCCTCCAGATCACGCAGAAGAGACCC
TTCCAAGGTCATTGCTGTGACTGCCAACGCCAGACGACGGAGCTCAAGGCCTGGCGTCTACTGACCAAGACGGCC
ACGTTGCGCCGCGGTCGTCACCTGTTCCCCTTTTCCGCCCTCCTCGAAGGCCGTCTGCCCGCCTGTCTGGACTCG
TCCATGCTGGTCATCGAGTACGTCTTCAAGGCCGAGGCCATGGTGCTACGGTCCAACGGCTCGTCACGCGCCAGT
GTCCGCTTCGGTCGCACCCTCGATGTCAAGCGCTCGCTGCCCGAGCCCCTCTACCCGCACCACTCGGTCCGCGTC
TTCCCTCCCACGAATATAAAGGCCAGCGCCCACTACAGCTCCGTCATCCATCCGACCGGCTCCAATCAGCTCACG
CTCAAGCTCGACGGCCTCACGTCGCGCAACGTCAAGGCTGGCACCGTCGATATCTGGCGTCTCAAGAAGGTGACG
TGGCGACTCGAGGAGACGGTCAAGACGTACGCACCCGCCTGCCGACGTCACGCGCCTCCTTCCTCTACATCGTCG
TCGTCTTGCTCTTCCTCTTCCTCCTCTTCCGCCCTCACAGACGACGACGACGACGACGATGACGACGATGACGTC
AACACTGGCGAAGACAGTGGCGATGGCGACGGCGACGGCTCGCACACCACTTCGGCACACCAGAAGCGCGTCTTT
CGCGTCAACACGCGGACCCTAGGCGAGAAGCAGCTCCATGACGGCTGGAAGTCGGACTTTAGCGGCCTCGACGGC
ACCGTCGACATGGAGTTCAACTTTGGCGTCCCCGTCGCTAAAACGCACTCTCGCGAGCCGACGTACGCCTGTGAC
ACCAAGACACGCGACGGTACCGATGTGTCGCACTCGCTCCTCATCGAGCTCATCGTGTCCAAGGAGTATGCACCC
GACGGCAAGCCTCACCTGGCGACGCAGACGGGCACGGGCCGTATCCTGCGCATGCACTTTGCCGTCGTCATGACC
GAGTTCCCGGGCCTGGGCGTCAGCTGGGACAACGAGTCGCCCCCGGTCTATCAGGACGTGCCGCCCAGTCCGCCG
GGGTACCCCTTTGCGCCCCCAATCGACTACGAGGAGCTCGAGGTGCTCGACACTCGGCGGCCCGAGAGGAGAAGC
TTGGAACCGTCACCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail