Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05952
Gene name
Locationscaffold_07:233937..237044
Strand+
Gene length (bp)3107
Transcript length (bp)2028
Coding sequence length (bp)2028
Protein length (aa) 676

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 1.3E-33 388 584
PF00141 peroxidase Peroxidase 9.0E-21 38 253

GO

GO Term Description Terminal node
GO:0006979 response to oxidative stress Yes
GO:0004601 peroxidase activity Yes
GO:0020037 heme binding Yes
GO:0016209 antioxidant activity No
GO:0050896 response to stimulus No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:1901363 heterocyclic compound binding No
GO:0046906 tetrapyrrole binding No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0005488 binding No
GO:0006950 response to stress No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.3376 0.1085 0.9384 0.1136 0.1073 0.1923 0.1036 0.1666 0.0721 0.0778

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA2 1.2E-52 35 281

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup72
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7755
Ophiocordyceps australis map64 (Brazil) OphauB2|5788
Ophiocordyceps camponoti-floridani Ophcf2|03380
Ophiocordyceps camponoti-floridani Ophcf2|05952 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06949
Ophiocordyceps camponoti-rufipedis Ophun1|2842
Ophiocordyceps camponoti-rufipedis Ophun1|490
Ophiocordyceps camponoti-rufipedis Ophun1|576
Ophiocordyceps kimflemingae Ophio5|1136
Ophiocordyceps kimflemingae Ophio5|3516
Ophiocordyceps kimflemingae Ophio5|4077
Ophiocordyceps kimflemingae Ophio5|6981
Ophiocordyceps subramaniannii Hirsu2|2648
Ophiocordyceps subramaniannii Hirsu2|7177
Ophiocordyceps subramaniannii Hirsu2|7933
Ophiocordyceps subramaniannii Hirsu2|9306

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05952
MLLKDIDGDDNTSVIGPVPPRDSAQCRQDTCCIWKYVAEEMRAAMTQQDGQCNDLARGCIRLGFHDAMDFSKTNN
TNAGADGSIVLAGECETVADNNGLKNTCNQMRVWFAKYQPYGVGMADLIQMAANVGTVVCPLGPRVRTFVGRKDS
TVRAPDGNLPLFTDSNDHILALMDDKTISPFGLIALLGAHSTAHARDVKPEIPGDHRLDSTPGVWDVAFYGEVLD
NSSTSANVFKLDSDVNLSRDQRTSDSWRFFVGQQPGQFRWDKAYAAEYVRVSMLGVNNMNNLTECTGVLPPFIPN
FKGITTPGSLPSSLLSSNRKSSPLHRKANSNQRARTRTQLPSDDQPSNARPELTAPTVTKRAIIIDPPVPETVHF
LISPITHTPTTEADENPVRGPCPGLNALANHGYLPRNGRGVNLLSITTQGLAGIGLSPEIGLIVGALGYVSKLAD
LTRLLSLQFDLDELAGHLVTLAIEHDCSFSREDYAVGDNNAFNPKLWQVVMDEIGGSDMVTSFALGKAKSKRIDE
EFTRHKTWYDPRAVAFGAIEVGLILTTLAPIGLGFLIGQVPLAWVRSLFEEERLPCDWAPFILKTNTITVLILGV
EALLADNKLPAHVVQGIVLTPQGILDALVHHRNGTRPDDDMRREHVALMRSAVIDMGLNTTGVDEIAKLWGNSNG
*
Coding >Ophcf2|05952
ATGCTCCTCAAGGACATCGACGGCGACGACAACACCTCGGTCATCGGACCCGTGCCTCCCCGGGACTCGGCGCAG
TGCAGACAGGACACGTGCTGTATCTGGAAGTACGTGGCCGAGGAGATGAGGGCGGCCATGACGCAGCAGGATGGA
CAGTGCAATGATCTCGCTCGGGGGTGTATCCGTCTCGGCTTCCACGATGCCATGGACTTTTCCAAGACGAACAAC
ACCAATGCCGGAGCCGATGGATCCATCGTCCTGGCGGGAGAGTGCGAGACGGTGGCCGATAACAACGGACTCAAA
AACACGTGCAACCAGATGAGAGTCTGGTTCGCAAAGTATCAACCCTACGGAGTCGGAATGGCAGATCTCATCCAG
ATGGCCGCAAACGTCGGAACGGTCGTCTGTCCCCTCGGCCCCCGAGTCCGAACCTTTGTCGGACGAAAAGACAGC
ACGGTCCGAGCCCCTGACGGGAACCTCCCTCTCTTCACGGACAGCAACGATCACATCCTCGCCCTCATGGACGAC
AAGACCATCTCCCCCTTTGGCCTCATCGCCCTGCTGGGCGCCCACTCGACGGCTCATGCCCGCGACGTGAAGCCC
GAGATTCCGGGGGATCATCGTCTGGATTCGACGCCGGGGGTCTGGGATGTTGCCTTTTACGGCGAGGTCTTGGAT
AATAGCTCGACGAGTGCGAACGTCTTCAAGTTGGATAGCGATGTGAATCTGAGTCGGGATCAGAGGACGAGTGAT
TCTTGGAGGTTCTTCGTCGGGCAGCAGCCGGGGCAGTTTCGCTGGGACAAGGCTTACGCGGCCGAGTACGTTCGC
GTCAGCATGCTGGGCGTCAACAACATGAACAACCTCACCGAGTGCACGGGGGTGCTGCCGCCGTTTATCCCTAAC
TTCAAGGGGATTACGACGCCGGGTTCCCTCCCCAGTTCCCTCCTCAGTTCCAACCGCAAAAGCAGTCCCCTTCAC
CGCAAAGCCAACAGCAACCAGAGGGCCCGAACCCGAACCCAACTCCCTTCCGACGACCAGCCGTCAAATGCCCGC
CCGGAACTCACGGCGCCGACCGTGACGAAAAGGGCCATTATTATCGACCCCCCGGTCCCGGAGACGGTACACTTC
CTAATCTCCCCCATAACTCACACTCCTACGACCGAGGCTGACGAGAATCCAGTCCGCGGCCCCTGTCCAGGCCTC
AACGCGCTGGCAAACCACGGCTACCTCCCCCGCAACGGAAGAGGCGTCAACCTCCTATCCATCACCACCCAAGGC
CTCGCCGGAATCGGCCTCTCGCCCGAGATAGGCCTCATCGTCGGCGCCTTGGGTTACGTCTCTAAGCTGGCGGAC
CTGACGCGCCTCCTCTCTCTGCAGTTCGACCTCGACGAGCTGGCCGGTCATCTCGTGACGCTGGCTATCGAGCAT
GACTGCAGCTTCTCGAGAGAAGACTACGCCGTCGGCGATAACAACGCTTTCAACCCTAAGCTGTGGCAGGTGGTC
ATGGACGAGATTGGAGGCTCCGACATGGTGACGTCTTTTGCTCTGGGAAAAGCCAAAAGTAAACGCATCGATGAG
GAGTTTACGAGGCACAAGACTTGGTATGATCCTCGAGCGGTTGCCTTTGGAGCCATCGAGGTCGGCTTGATTCTC
ACGACATTGGCGCCCATCGGACTGGGTTTTCTCATCGGTCAGGTTCCCCTCGCCTGGGTGAGGTCTCTGTTCGAA
GAGGAAAGGCTTCCGTGCGACTGGGCGCCCTTTATTCTCAAGACGAACACCATTACCGTCCTGATTCTCGGCGTC
GAAGCTTTACTGGCCGATAATAAGCTACCGGCTCATGTCGTTCAAGGCATCGTCCTCACACCGCAGGGAATCTTG
GACGCACTTGTTCATCACCGGAACGGCACGAGGCCTGACGATGATATGAGAAGGGAGCACGTAGCTCTCATGAGA
AGCGCCGTCATCGACATGGGTCTGAACACGACGGGGGTAGATGAAATAGCCAAGCTATGGGGTAATTCAAACGGT
TGA
Transcript >Ophcf2|05952
ATGCTCCTCAAGGACATCGACGGCGACGACAACACCTCGGTCATCGGACCCGTGCCTCCCCGGGACTCGGCGCAG
TGCAGACAGGACACGTGCTGTATCTGGAAGTACGTGGCCGAGGAGATGAGGGCGGCCATGACGCAGCAGGATGGA
CAGTGCAATGATCTCGCTCGGGGGTGTATCCGTCTCGGCTTCCACGATGCCATGGACTTTTCCAAGACGAACAAC
ACCAATGCCGGAGCCGATGGATCCATCGTCCTGGCGGGAGAGTGCGAGACGGTGGCCGATAACAACGGACTCAAA
AACACGTGCAACCAGATGAGAGTCTGGTTCGCAAAGTATCAACCCTACGGAGTCGGAATGGCAGATCTCATCCAG
ATGGCCGCAAACGTCGGAACGGTCGTCTGTCCCCTCGGCCCCCGAGTCCGAACCTTTGTCGGACGAAAAGACAGC
ACGGTCCGAGCCCCTGACGGGAACCTCCCTCTCTTCACGGACAGCAACGATCACATCCTCGCCCTCATGGACGAC
AAGACCATCTCCCCCTTTGGCCTCATCGCCCTGCTGGGCGCCCACTCGACGGCTCATGCCCGCGACGTGAAGCCC
GAGATTCCGGGGGATCATCGTCTGGATTCGACGCCGGGGGTCTGGGATGTTGCCTTTTACGGCGAGGTCTTGGAT
AATAGCTCGACGAGTGCGAACGTCTTCAAGTTGGATAGCGATGTGAATCTGAGTCGGGATCAGAGGACGAGTGAT
TCTTGGAGGTTCTTCGTCGGGCAGCAGCCGGGGCAGTTTCGCTGGGACAAGGCTTACGCGGCCGAGTACGTTCGC
GTCAGCATGCTGGGCGTCAACAACATGAACAACCTCACCGAGTGCACGGGGGTGCTGCCGCCGTTTATCCCTAAC
TTCAAGGGGATTACGACGCCGGGTTCCCTCCCCAGTTCCCTCCTCAGTTCCAACCGCAAAAGCAGTCCCCTTCAC
CGCAAAGCCAACAGCAACCAGAGGGCCCGAACCCGAACCCAACTCCCTTCCGACGACCAGCCGTCAAATGCCCGC
CCGGAACTCACGGCGCCGACCGTGACGAAAAGGGCCATTATTATCGACCCCCCGGTCCCGGAGACGGTACACTTC
CTAATCTCCCCCATAACTCACACTCCTACGACCGAGGCTGACGAGAATCCAGTCCGCGGCCCCTGTCCAGGCCTC
AACGCGCTGGCAAACCACGGCTACCTCCCCCGCAACGGAAGAGGCGTCAACCTCCTATCCATCACCACCCAAGGC
CTCGCCGGAATCGGCCTCTCGCCCGAGATAGGCCTCATCGTCGGCGCCTTGGGTTACGTCTCTAAGCTGGCGGAC
CTGACGCGCCTCCTCTCTCTGCAGTTCGACCTCGACGAGCTGGCCGGTCATCTCGTGACGCTGGCTATCGAGCAT
GACTGCAGCTTCTCGAGAGAAGACTACGCCGTCGGCGATAACAACGCTTTCAACCCTAAGCTGTGGCAGGTGGTC
ATGGACGAGATTGGAGGCTCCGACATGGTGACGTCTTTTGCTCTGGGAAAAGCCAAAAGTAAACGCATCGATGAG
GAGTTTACGAGGCACAAGACTTGGTATGATCCTCGAGCGGTTGCCTTTGGAGCCATCGAGGTCGGCTTGATTCTC
ACGACATTGGCGCCCATCGGACTGGGTTTTCTCATCGGTCAGGTTCCCCTCGCCTGGGTGAGGTCTCTGTTCGAA
GAGGAAAGGCTTCCGTGCGACTGGGCGCCCTTTATTCTCAAGACGAACACCATTACCGTCCTGATTCTCGGCGTC
GAAGCTTTACTGGCCGATAATAAGCTACCGGCTCATGTCGTTCAAGGCATCGTCCTCACACCGCAGGGAATCTTG
GACGCACTTGTTCATCACCGGAACGGCACGAGGCCTGACGATGATATGAGAAGGGAGCACGTAGCTCTCATGAGA
AGCGCCGTCATCGACATGGGTCTGAACACGACGGGGGTAGATGAAATAGCCAAGCTATGGGGTAATTCAAACGGT
TGA
Gene >Ophcf2|05952
ATGCTCCTCAAGGACATCGACGGCGACGACAACACCTCGGTCATCGGACCCGTGCCTCCCCGGGACTCGGCGCAG
TGCAGACAGGACACGTGCTGTATCTGGAAGTACGTGGCCGAGGAGATGAGGGCGGCCATGACGCAGCAGGATGGA
CAGTGCAATGATCTCGCTCGGGGGTGTATCCGTCTCGGCTTCCACGATGCCATGGACTTTTCCAAGACGAACAAC
ACCAATGCCGGAGCCGATGGATCCATCGTCCTGGCGGGAGAGTGCGAGACGGTGGCCGATAACAACGGACTCAAA
AACACGTGCAACCAGATGAGAGTCTGGTTCGCAAAGTATCAACCCTACGGAGTCGGAATGGCAGATCTCATCCAG
ATGGCCGCAAACGTCGGAACGGTCGTCTGTCCCCTCGGCCCCCGAGTCCGAACCTTTGTCGGACGAAAAGACAGC
ACGGTCCGAGCCCCTGACGGGAACCTCCCTCTCTTCACGGACAGCAACGATCACATCCTCGCCCTCATGGACGAC
AAGACCATCTCCCCCTTTGGCCTCATCGCCCTGCTGGGCGCCCACTCGACGGCTCATGCCCGCGACGTGAAGCCC
GAGATTCCGGGGGATCATCGTCTGGATTCGACGCCGGGGGTCTGGGATGTTGCCTTTTACGGCGAGGTCTTGGAT
AATAGCTCGACGAGTGCGAACGTCTTCAAGTTGGATAGCGATGTGAATCTGAGTCGGGATCAGAGGACGAGTGAT
TCTTGGAGGTTCTTCGTCGGGCAGCAGCCGGGGCAGTTTCGCTGGGACAAGGTGAGTCTTTTCTTCTTACTGAAA
TCCCCATCTCGCTCGGAGGCTAACAGTTGAGGAAAAGGCTTACGCGGCCGAGTACGTTCGCGTCAGCATGCTGGG
CGTCAACAACATGAACAACCTCACCGAGTGCACGGGGGTGCTGCCGCCGTTTATCCCTAACTTCAAGGGGATTAC
GACGCCGGGGTTGGGGTGATTGGAGGGGGCAAGACGACGGGAAAAGGGGAGTTGATGGTTGTGTCACGGCCTTGA
TGTTTGTTTTGGATGGGAGCGGGTTATGTATGTTTCTTTGACCATGTTAAGAGATGGAAGCGTGGCGACTGGAGA
TTCATCTGCGTATATGTGATGCTTGGTGAGATCTACCAGTTCGATCAGACCCGGCTGGTAGTTACGTGTACTTGC
TTTGAAATGCCGTCTCAACCATTCAATCGAAGCTTACATAGGTTGCTTGCTGACAGTTGTGACCAGTTGCCTGAC
CAGACCCAACTCCTTCTAAAGCTCCCATCCCAGCCAACATCAGACAAAGATCGCCGTCGAAATACCCACCAGCAC
GTAACAAGCATATCCATCGTTTCCCCAAATCTCGATATCACCCAATGTCTCGCCCCGTTGCCTCGCGTACTCGAA
ACCAAAAGTCCACCACCTGCAACTCAACCCCCATCAGAGACACGACCAAGGACCACATGTCGTCCAGACACATGG
CCCTCCATTCCAACTCCCCATTCCCCTCCCCTGCACCAACGCAAGAAGCACATCCCGCTAGGGTACGTCACGGAA
TGCAGCAAACCATGGGACGGCCAGCGGGACGACGCCATGACGTTGCTACAGGTTGTACCCCCTTCGTTGGATATA
TACGTGTACACATCGCCCTTGTACGAATCTCTCATCAACGTGGCAATTCTTCAACTTCTCAGAATGCCGGCTTGG
CACCTCGTTTCCTTGGCTTTGGTGGCAGTCTCTGCCCCGGCGACTGGCTTCCCCCAATTCGGACGCTCGTCTCAG
CCCGGATTTCCGAACAGACAGTTCCAGAGTGGGTTTGGTCGGCCGTCGGGTCAGTTCCGGGGGGGCTTCAACCAG
TTTCCTTCTCCTCGCTTCAACCAGTTCCCTGGTGGCTTCAACCAGTTTCCTTCTCCGCAGTTCCCTCCCCAGTTC
CCTCCTCAGTTCCAACCGCAAAAGCAGTCCCCTTCACCGCAAAGCCAACAGCAACCAGAGGGCCCGAACCCGAAC
CCAACTCCCTTCCGACGACCAGCCGTCAAATGCCCGCCCGGAACTCACGGCGCCGACCGTGACGAAAAGGGCCAT
TATTATCGACCCCCCGGTCCCGGAGACGGTACACTTCCTAATCTCCCCCATAACTCACACTCCTACGACCGAGGC
TGACGAGAATCCAGTCCGCGGCCCCTGTCCAGGCCTCAACGCGCTGGCAAACCACGGCTACCTCCCCCGCAACGG
AAGAGGCGTCAACCTCCTATCCATCACCACCCAAGGCCTCGCCGGAATCGGCCTCTCGCCCGAGATAGGCCTCAT
CGTCGGCGCCTTGGGTTACGTCTCTAAGCTGGCGGACCTGACGCGCCTCCTCTCTCTGCAGTTCGACCTCGACGA
GCTGGCCGGTCATCTCGTGACGCTGGCTATCGAGCATGACTGCAGCTTCTCGAGAGAAGACTACGCCGTCGGCGA
TAACAACGCTTTCAACCCTAAGCTGTGGCAGGTGGTCATGGACGAGATTGGAGGCTCCGACATGGTGACGTCTTT
TGCTCTGGGAAAAGCCAAAAGTAAACGCATCGATGAGGAGTTTACGAGGCACAAGACTTGGTATGATCCTCGAGC
GGTTGCCTTTGGAGCCATCGAGGTCGGCTTGATTCTCACGACATTGGCGCCCATCGGACTGGGTTTTCTCATCGG
TCAGGTTCCCCTCGCCTGGGTGAGGTCTCTGTTCGAAGAGGAAAGGCTTCCGTGCGACTGGGCGCCCTTTATTCT
CAAGACGAACACCATTACCGTCCTGATTCTCGGCGTCGAAGCTTTACTGGCCGATAATAAGCTACCGGCTCATGT
CGTTCAAGGCATCGTCCTCACACCGCAGGTACTTTCCACCCCTCGATGCTAACGGGTATACAGGCGGTGATGTTT
ACGGCTGATGATTTACGCAGGGAATCTTGGACGCACTTGTTCATCACCGGAACGGCACGAGGCCTGACGATGATA
TGAGAAGGGAGCACGTAGCTCTCATGAGAAGCGCCGTCATCGACATGGGTCTGAACACGACGGGGGTAGATGAAA
TAGCCAAGCTATGGGGTAATTCAAACGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail