Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05935
Gene name
Locationscaffold_07:174097..175417
Strand+
Gene length (bp)1320
Transcript length (bp)1320
Coding sequence length (bp)1320
Protein length (aa) 440

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10392 COG5 Golgi transport complex subunit 5 2.6E-37 20 152

GO

GO Term Description Terminal node
GO:0006891 intra-Golgi vesicle-mediated transport Yes
GO:0017119 Golgi transport complex Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0048193 Golgi vesicle transport No
GO:0016192 vesicle-mediated transport No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0006810 transport No
GO:0099023 vesicle tethering complex No
GO:0051234 establishment of localization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5257 0.433 0.3711 0.0446 0.0566 0.0027 0.1539 0.5212 0.5434 0.0476

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5362
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3985
Ophiocordyceps australis map64 (Brazil) OphauB2|4767
Ophiocordyceps camponoti-floridani Ophcf2|05935 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4497
Ophiocordyceps kimflemingae Ophio5|2996
Ophiocordyceps subramaniannii Hirsu2|5277

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05935
MSGSVPGHDEADPPSYVDYETFLDPKFSATSFANSLVLATNNANDSPLDLSTPLSRVLFDAQELDTHIDLVATRH
AVPLLEYTRAQNEASQRIIAELDPQVHSLNESYRRLEKDVIDRHAEADEVRQVALRLWETLRLARAAARCLQLGR
QLELQHAGLADDDHGALVRCAQTILSLREVLDSQAPGEEGYGLGKLDAIRALGESVLAPIQRSVRHAAERLVRDF
SIPATMTFANASEVRAKTESALTALYLLSPTAGVNIQRWTPQLLLQALETYMRSSLQTSVATLSRALSQLPTMDK
ALTEVAARCQNLVSIELILESISPPEHLLLPSDTEKPPSLARPVLTHLETRSLASYFWRTLAGSFASRVQDVTSR
PGAVSRALKSNKNALGDAIRQAVVKGCKPPSAMVDGKSRGRAEEANWDREAAVMVGSLVNNLGR*
Coding >Ophcf2|05935
ATGTCCGGCTCGGTCCCCGGCCACGACGAGGCCGATCCCCCTTCGTACGTCGACTACGAGACCTTTCTCGACCCC
AAATTCTCCGCCACCAGCTTCGCGAACTCGCTCGTCCTCGCTACTAACAACGCCAACGACTCTCCCCTCGACCTC
TCCACGCCCCTCTCCCGTGTCCTCTTTGACGCCCAGGAGCTGGACACGCACATTGACCTCGTCGCCACTCGCCAT
GCCGTACCCCTTCTCGAGTATACCCGGGCTCAGAATGAAGCTAGCCAGCGCATCATCGCCGAGCTGGACCCCCAG
GTTCACAGCCTAAACGAGAGCTACCGCCGCCTAGAAAAGGACGTCATCGACAGGCACGCCGAGGCCGACGAGGTG
CGCCAAGTTGCTCTGCGCCTGTGGGAGACGTTACGTCTCGCCCGCGCCGCTGCTCGCTGCCTCCAACTCGGCCGC
CAGCTCGAACTCCAGCACGCCGGGCTCGCTGACGACGACCACGGCGCCCTGGTCCGTTGCGCCCAAACCATTCTC
TCCCTTCGCGAGGTTCTCGACAGCCAGGCTCCGGGCGAAGAGGGTTACGGGCTAGGCAAGCTCGACGCCATTCGC
GCCCTCGGCGAGTCTGTACTGGCTCCCATTCAGCGGTCCGTTCGACACGCCGCCGAGCGCCTCGTCCGCGACTTT
TCCATTCCCGCCACCATGACGTTCGCCAACGCTTCAGAGGTCCGCGCAAAGACGGAGTCCGCCTTGACGGCGCTG
TATCTGCTTTCACCCACTGCCGGCGTCAATATCCAGCGATGGACGCCGCAGTTGCTGCTGCAGGCCCTCGAGACG
TATATGCGCTCCTCACTGCAGACCAGCGTCGCCACACTCTCTCGCGCCCTGAGCCAGCTTCCCACCATGGACAAG
GCCCTGACCGAAGTGGCGGCGCGGTGCCAGAATCTCGTCTCCATCGAGCTAATTCTCGAGTCCATCAGCCCGCCT
GAACACCTACTGCTACCCTCCGACACCGAGAAACCGCCGAGCCTGGCGCGACCGGTGCTGACCCATCTTGAGACG
AGGTCGCTGGCATCATACTTCTGGCGCACCCTCGCCGGCAGCTTCGCGTCCCGCGTTCAGGACGTGACCAGCCGT
CCGGGCGCCGTTTCCAGGGCGCTCAAGTCCAACAAGAACGCGCTGGGCGACGCCATTCGGCAGGCCGTCGTCAAG
GGATGCAAGCCGCCGTCCGCCATGGTCGACGGGAAGAGCCGGGGCCGGGCAGAAGAGGCCAATTGGGATCGTGAG
GCGGCCGTCATGGTGGGCAGCTTGGTGAACAATCTAGGCAGATAA
Transcript >Ophcf2|05935
ATGTCCGGCTCGGTCCCCGGCCACGACGAGGCCGATCCCCCTTCGTACGTCGACTACGAGACCTTTCTCGACCCC
AAATTCTCCGCCACCAGCTTCGCGAACTCGCTCGTCCTCGCTACTAACAACGCCAACGACTCTCCCCTCGACCTC
TCCACGCCCCTCTCCCGTGTCCTCTTTGACGCCCAGGAGCTGGACACGCACATTGACCTCGTCGCCACTCGCCAT
GCCGTACCCCTTCTCGAGTATACCCGGGCTCAGAATGAAGCTAGCCAGCGCATCATCGCCGAGCTGGACCCCCAG
GTTCACAGCCTAAACGAGAGCTACCGCCGCCTAGAAAAGGACGTCATCGACAGGCACGCCGAGGCCGACGAGGTG
CGCCAAGTTGCTCTGCGCCTGTGGGAGACGTTACGTCTCGCCCGCGCCGCTGCTCGCTGCCTCCAACTCGGCCGC
CAGCTCGAACTCCAGCACGCCGGGCTCGCTGACGACGACCACGGCGCCCTGGTCCGTTGCGCCCAAACCATTCTC
TCCCTTCGCGAGGTTCTCGACAGCCAGGCTCCGGGCGAAGAGGGTTACGGGCTAGGCAAGCTCGACGCCATTCGC
GCCCTCGGCGAGTCTGTACTGGCTCCCATTCAGCGGTCCGTTCGACACGCCGCCGAGCGCCTCGTCCGCGACTTT
TCCATTCCCGCCACCATGACGTTCGCCAACGCTTCAGAGGTCCGCGCAAAGACGGAGTCCGCCTTGACGGCGCTG
TATCTGCTTTCACCCACTGCCGGCGTCAATATCCAGCGATGGACGCCGCAGTTGCTGCTGCAGGCCCTCGAGACG
TATATGCGCTCCTCACTGCAGACCAGCGTCGCCACACTCTCTCGCGCCCTGAGCCAGCTTCCCACCATGGACAAG
GCCCTGACCGAAGTGGCGGCGCGGTGCCAGAATCTCGTCTCCATCGAGCTAATTCTCGAGTCCATCAGCCCGCCT
GAACACCTACTGCTACCCTCCGACACCGAGAAACCGCCGAGCCTGGCGCGACCGGTGCTGACCCATCTTGAGACG
AGGTCGCTGGCATCATACTTCTGGCGCACCCTCGCCGGCAGCTTCGCGTCCCGCGTTCAGGACGTGACCAGCCGT
CCGGGCGCCGTTTCCAGGGCGCTCAAGTCCAACAAGAACGCGCTGGGCGACGCCATTCGGCAGGCCGTCGTCAAG
GGATGCAAGCCGCCGTCCGCCATGGTCGACGGGAAGAGCCGGGGCCGGGCAGAAGAGGCCAATTGGGATCGTGAG
GCGGCCGTCATGGTGGGCAGCTTGGTGAACAATCTAGGCAGATAA
Gene >Ophcf2|05935
ATGTCCGGCTCGGTCCCCGGCCACGACGAGGCCGATCCCCCTTCGTACGTCGACTACGAGACCTTTCTCGACCCC
AAATTCTCCGCCACCAGCTTCGCGAACTCGCTCGTCCTCGCTACTAACAACGCCAACGACTCTCCCCTCGACCTC
TCCACGCCCCTCTCCCGTGTCCTCTTTGACGCCCAGGAGCTGGACACGCACATTGACCTCGTCGCCACTCGCCAT
GCCGTACCCCTTCTCGAGTATACCCGGGCTCAGAATGAAGCTAGCCAGCGCATCATCGCCGAGCTGGACCCCCAG
GTTCACAGCCTAAACGAGAGCTACCGCCGCCTAGAAAAGGACGTCATCGACAGGCACGCCGAGGCCGACGAGGTG
CGCCAAGTTGCTCTGCGCCTGTGGGAGACGTTACGTCTCGCCCGCGCCGCTGCTCGCTGCCTCCAACTCGGCCGC
CAGCTCGAACTCCAGCACGCCGGGCTCGCTGACGACGACCACGGCGCCCTGGTCCGTTGCGCCCAAACCATTCTC
TCCCTTCGCGAGGTTCTCGACAGCCAGGCTCCGGGCGAAGAGGGTTACGGGCTAGGCAAGCTCGACGCCATTCGC
GCCCTCGGCGAGTCTGTACTGGCTCCCATTCAGCGGTCCGTTCGACACGCCGCCGAGCGCCTCGTCCGCGACTTT
TCCATTCCCGCCACCATGACGTTCGCCAACGCTTCAGAGGTCCGCGCAAAGACGGAGTCCGCCTTGACGGCGCTG
TATCTGCTTTCACCCACTGCCGGCGTCAATATCCAGCGATGGACGCCGCAGTTGCTGCTGCAGGCCCTCGAGACG
TATATGCGCTCCTCACTGCAGACCAGCGTCGCCACACTCTCTCGCGCCCTGAGCCAGCTTCCCACCATGGACAAG
GCCCTGACCGAAGTGGCGGCGCGGTGCCAGAATCTCGTCTCCATCGAGCTAATTCTCGAGTCCATCAGCCCGCCT
GAACACCTACTGCTACCCTCCGACACCGAGAAACCGCCGAGCCTGGCGCGACCGGTGCTGACCCATCTTGAGACG
AGGTCGCTGGCATCATACTTCTGGCGCACCCTCGCCGGCAGCTTCGCGTCCCGCGTTCAGGACGTGACCAGCCGT
CCGGGCGCCGTTTCCAGGGCGCTCAAGTCCAACAAGAACGCGCTGGGCGACGCCATTCGGCAGGCCGTCGTCAAG
GGATGCAAGCCGCCGTCCGCCATGGTCGACGGGAAGAGCCGGGGCCGGGCAGAAGAGGCCAATTGGGATCGTGAG
GCGGCCGTCATGGTGGGCAGCTTGGTGAACAATCTAGGCAGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail