Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05933
Gene name
Locationscaffold_07:170736..171444
Strand+
Gene length (bp)708
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04117 Mpv17_PMP22 Mpv17 / PMP22 family 9.2E-20 127 188

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 107 129 22
2 144 166 22
3 173 192 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 24.74 9.03 40.46
Alive In ants, during behavior modification 64.44 27.68 101.20
Dead In ants, recently dead 51.70 23.68 79.72

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.318191 no
Dead Fungus 0.003907 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05933
MPSPILTATLQAAGLSMASNLMAQFLEAYQNQHAFVPDHRQLCRFLALTLIITPPNYMWQQFLERCFPSHPRPST
PTTTFELKTAEEAAPPPTARPLSLFNTATKWFVDCITMGALANTVAFLVLMGLLKGQPALRIWDNVRSETIPIII
AGYKIWPLASVISFSFVPVHRRVVFLSFVGLLWGIYMSLIAARV*
Coding >Ophcf2|05933
ATGCCCTCTCCCATTCTGACGGCCACCCTCCAAGCCGCGGGCCTGTCCATGGCCTCGAACCTGATGGCCCAGTTC
CTCGAAGCCTATCAGAATCAGCACGCCTTTGTCCCAGATCATCGTCAGCTATGCCGCTTCCTCGCCCTCACCCTC
ATCATCACGCCACCCAACTACATGTGGCAGCAATTTCTAGAGCGATGTTTCCCCTCGCATCCGCGTCCTTCAACC
CCGACCACGACCTTCGAGCTCAAGACGGCTGAAGAGGCCGCGCCGCCGCCAACAGCCCGGCCGCTGAGCCTCTTC
AATACCGCTACCAAGTGGTTCGTCGACTGCATTACAATGGGCGCTCTGGCCAATACCGTTGCCTTCTTGGTGCTC
ATGGGCTTGCTCAAGGGTCAACCTGCGCTGCGCATCTGGGATAACGTCCGCTCAGAAACGATACCCATCATCATC
GCCGGTTACAAGATCTGGCCGCTGGCTTCCGTCATCAGCTTCTCCTTTGTGCCCGTCCATCGGCGAGTCGTCTTC
CTTAGCTTCGTCGGCCTGCTGTGGGGGATTTACATGAGTCTCATCGCCGCGCGTGTCTAG
Transcript >Ophcf2|05933
ATGCCCTCTCCCATTCTGACGGCCACCCTCCAAGCCGCGGGCCTGTCCATGGCCTCGAACCTGATGGCCCAGTTC
CTCGAAGCCTATCAGAATCAGCACGCCTTTGTCCCAGATCATCGTCAGCTATGCCGCTTCCTCGCCCTCACCCTC
ATCATCACGCCACCCAACTACATGTGGCAGCAATTTCTAGAGCGATGTTTCCCCTCGCATCCGCGTCCTTCAACC
CCGACCACGACCTTCGAGCTCAAGACGGCTGAAGAGGCCGCGCCGCCGCCAACAGCCCGGCCGCTGAGCCTCTTC
AATACCGCTACCAAGTGGTTCGTCGACTGCATTACAATGGGCGCTCTGGCCAATACCGTTGCCTTCTTGGTGCTC
ATGGGCTTGCTCAAGGGTCAACCTGCGCTGCGCATCTGGGATAACGTCCGCTCAGAAACGATACCCATCATCATC
GCCGGTTACAAGATCTGGCCGCTGGCTTCCGTCATCAGCTTCTCCTTTGTGCCCGTCCATCGGCGAGTCGTCTTC
CTTAGCTTCGTCGGCCTGCTGTGGGGGATTTACATGAGTCTCATCGCCGCGCGTGTCTAG
Gene >Ophcf2|05933
ATGCCCTCTCCCATTCTGACGGCCACCCTCCAAGCCGCGGGCCTGTCCATGGCCTCGAACCTGATGGCCCAGTTC
CTCGAAGCCTATCAGAATCAGGTACGACGAGCATCGTAATTGCTCCTCCTCTCCTCCTCCGCCTCCTCTCCCTCC
CGCTCACCGCGTCGCAGCACGCCTTTGTCCCAGATCATCGTCAGCTATGCCGCTTCCTCGCCCTCACCCTCATCA
TCACGCCACCCAACTACATGTGGCAGCAATTTCTAGAGCGATGTTTCCCCTCGCATCCGCGTCCTTCAACCCCGA
CCACGACCTTCGAGCTCAAGACGGCTGAAGAGGCCGCGCCGCCGCCAACAGCCCGGCCGCTGAGCCTCTTCAATA
CCGCTACCAAGTGGTTCGTCGACTGCATTACAATGGGCGCTCTGGCCAATACCGTTGCCTTCTTGGTGCTCATGG
GCTTGCTCAAGGGTCAACCTGCGCTGCGCATCTGGGATAACGTCCGCTCAGTGCGTCAGAGTCTCCATCAATGTT
GAAGCTTCATGGCTGACCATCTAGCAGGAAACGATACCCATCATCATCGCCGGTTACAAGATCTGGCCGCTGGCT
TCCGTCATCAGCTTCTCCTTTGTGCCCGTCCATCGGCGAGTCGTCTTCCTTAGCTTCGTCGGCCTGCTGTGGGGG
ATTTACATGAGTCTCATCGCCGCGCGTGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail