Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05929
Gene name
Locationscaffold_07:156901..159483
Strand-
Gene length (bp)2582
Transcript length (bp)2472
Coding sequence length (bp)2472
Protein length (aa) 824

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00982 Glyco_transf_20 Glycosyltransferase family 20 1.0E-140 38 513
PF02358 Trehalose_PPase Trehalose-phosphatase 2.6E-71 548 784

GO

GO Term Description Terminal node
GO:0005992 trehalose biosynthetic process Yes
GO:0003824 catalytic activity Yes
GO:0005984 disaccharide metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0005991 trehalose metabolic process No
GO:0009311 oligosaccharide metabolic process No
GO:0008152 metabolic process No
GO:0046351 disaccharide biosynthetic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016051 carbohydrate biosynthetic process No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0005975 carbohydrate metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009312 oligosaccharide biosynthetic process No
GO:0008150 biological_process No
GO:0034637 cellular carbohydrate biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.721 0.3929 0.2455 0.0774 0.3034 0.0453 0.0912 0.2704 0.186 0.0211

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT20 2.9E-150 16 512

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup489
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4071
Ophiocordyceps australis map64 (Brazil) OphauB2|7163
Ophiocordyceps camponoti-floridani Ophcf2|03847
Ophiocordyceps camponoti-floridani Ophcf2|05929 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3698
Ophiocordyceps camponoti-rufipedis Ophun1|5223
Ophiocordyceps kimflemingae Ophio5|6531
Ophiocordyceps subramaniannii Hirsu2|10969

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05929
MTRRESLDELRAVNPDLALSGNIISVTFDLPHALRYCEDGDWHLKPRRGQSALLDALAYLSSDATAWSHTVVAWT
GEIETPSDELRLSREARKRLEHKLARGGNIRAVPVWLADDDDDDDDDDDDDDDDEDDAIRLRDQSRWRRYAQHEL
FALLHYQQNEPTDGRRERVQWADYYRMNQIFADRVLQVYRPGDVVIVHDYPLMLLPSMLRRKAPTMHMSFFLHCP
FPSSEFVRCLPRRKEVLEGVLGANLVGFQSYSYSRHFLSCCTRILGFPSDTLGVDAYGSRVQVGVFPVGIDTAKV
EALAWREPVGVKLEALRALYAGKKIIVGRDRLDSVRGVAQKLQAFERFLELYPAWRQRVVLIQVTSPAGSSGDGD
SRVNELVVRINGQYGSLDFAPVQHYPHYLSQDEYFALLRAADIGLITSVRDGMNTMSFEFVVCQKQGRGPLMLSE
FSGSATSLGDAIHINPWDLTGVADGIHAALTMADEARTEMHDRLYCHVRRHDAQSWMTRLIRKACSVLAEATTAT
TPPLDGALLLSRYRAARGRRLFMLDYDGTLTPIVREPSAAVPSERVVEALRLLAADSRNAVWIISGRDQDFLGRH
LGHIPRLGFSAEHGSFVRQPGEDRWSNLAEKLDMGWQADVMAVFQTYTDRVPGSFIERKRCALTWHYRLAEPNLG
PEMARRCQAELEAGVGRRWEVEVMPGKANIEVRPTMVNKGEIAKRLVATYRESDGLDFALCMGDDFTDEDMFRTL
NGASGAVLGADDVFTVTVGAGTKATLAKWHLLEPQDVIDCVALLAAEHETGQEQTGGVNLAALSVVEGHIPQA*
Coding >Ophcf2|05929
ATGACGCGCCGCGAATCGCTCGACGAGCTCCGCGCTGTCAATCCGGACCTGGCCCTCAGCGGGAACATCATCTCC
GTCACCTTTGACCTCCCTCATGCGCTCAGATATTGTGAGGACGGCGATTGGCATCTCAAGCCCCGTCGCGGTCAG
TCGGCTCTTTTGGACGCTCTGGCCTATCTCTCGTCCGACGCAACGGCCTGGAGTCACACCGTCGTCGCTTGGACG
GGCGAGATCGAGACTCCCTCTGACGAGCTGCGCCTCAGTCGTGAGGCCCGAAAGCGGCTCGAGCATAAGCTCGCT
CGCGGCGGCAATATCCGAGCCGTGCCTGTCTGGCTGGCCGATGATGATGATGACGACGACGACGACGACGACGAC
GACGACGACGATGAAGACGACGCCATCCGTCTACGAGATCAGTCCCGCTGGCGTCGTTACGCTCAACACGAGCTC
TTCGCCCTCCTCCACTACCAGCAGAACGAGCCGACCGACGGGCGACGCGAGCGCGTGCAATGGGCCGACTACTAC
CGCATGAACCAGATCTTCGCCGACCGAGTTCTCCAAGTCTACCGGCCTGGCGACGTCGTCATCGTCCACGACTAT
CCGTTGATGCTACTGCCCAGTATGCTGCGGCGGAAAGCACCGACCATGCACATGTCCTTTTTCCTACACTGCCCG
TTTCCCAGCAGCGAGTTCGTCCGCTGTCTCCCGCGGCGCAAGGAGGTGCTCGAGGGCGTCTTGGGTGCTAACCTG
GTGGGTTTCCAGTCGTACAGCTACTCGCGCCACTTCCTCAGCTGCTGCACCCGCATCCTCGGCTTCCCTTCGGAC
ACTCTGGGCGTCGACGCGTACGGGTCGCGCGTCCAGGTGGGCGTCTTTCCCGTCGGCATCGATACGGCCAAGGTG
GAAGCGCTGGCCTGGCGCGAGCCCGTGGGCGTCAAGCTCGAGGCCCTCAGGGCTCTGTATGCCGGCAAGAAGATC
ATAGTCGGGCGCGACCGGCTCGACAGCGTTCGAGGCGTGGCCCAGAAGCTTCAGGCCTTTGAACGCTTCCTCGAA
CTGTACCCGGCCTGGCGACAGCGCGTCGTCCTCATCCAGGTGACGTCACCAGCCGGCAGCAGTGGCGATGGAGAC
TCGCGCGTCAACGAGCTCGTGGTTCGCATAAACGGACAGTACGGGAGCCTCGACTTTGCGCCCGTTCAGCATTAC
CCGCACTATCTGAGCCAGGACGAGTACTTTGCGCTGCTGCGGGCTGCCGACATCGGACTCATCACGTCTGTGCGC
GACGGCATGAACACCATGAGCTTCGAGTTCGTCGTCTGTCAGAAGCAGGGTCGAGGACCGCTGATGCTGTCCGAG
TTCAGCGGCAGTGCCACCAGCCTGGGCGACGCCATTCACATCAATCCGTGGGACCTTACGGGCGTCGCCGACGGC
ATCCACGCGGCGCTGACCATGGCTGACGAGGCCCGAACCGAGATGCACGACCGGCTTTACTGCCACGTTCGCCGT
CACGATGCCCAGTCGTGGATGACGAGGCTGATACGAAAGGCCTGTAGCGTGCTGGCAGAGGCGACGACGGCCACG
ACTCCTCCCCTGGACGGCGCTCTGCTACTGAGCCGTTACCGGGCCGCGCGCGGGAGGCGGCTATTCATGCTCGAC
TACGACGGCACGCTGACGCCCATCGTTCGCGAGCCCAGCGCGGCTGTGCCTTCGGAACGCGTCGTCGAGGCCCTA
CGACTGCTGGCGGCCGACTCCCGGAACGCCGTCTGGATCATCTCGGGCCGCGATCAGGACTTTCTCGGTCGTCAC
CTCGGTCACATACCGCGCTTGGGCTTCTCGGCCGAGCACGGCAGCTTCGTCCGCCAGCCGGGTGAGGACCGGTGG
AGCAACCTGGCGGAGAAGCTGGACATGGGCTGGCAGGCCGACGTCATGGCCGTGTTTCAGACGTACACGGACAGG
GTTCCCGGCTCCTTCATCGAGCGCAAGCGCTGCGCCCTGACCTGGCACTACCGGCTCGCCGAACCGAACCTCGGG
CCCGAAATGGCGAGAAGGTGTCAGGCCGAACTCGAGGCCGGCGTCGGTCGTCGGTGGGAGGTCGAGGTGATGCCT
GGAAAGGCCAATATCGAGGTTCGGCCGACCATGGTCAACAAGGGGGAGATTGCCAAGCGGCTGGTGGCTACGTAT
CGCGAGTCAGACGGTCTGGACTTTGCCCTCTGCATGGGCGACGACTTTACCGACGAGGACATGTTCCGGACGCTC
AACGGCGCTTCCGGGGCGGTGCTCGGGGCCGACGACGTCTTCACCGTCACCGTCGGGGCCGGGACCAAGGCGACG
CTGGCCAAGTGGCATCTCCTCGAGCCCCAAGACGTCATCGACTGCGTGGCGTTACTCGCGGCCGAGCACGAAACG
GGTCAGGAGCAGACGGGAGGCGTGAACCTGGCGGCGCTGAGTGTGGTTGAGGGACACATTCCACAGGCTTGA
Transcript >Ophcf2|05929
ATGACGCGCCGCGAATCGCTCGACGAGCTCCGCGCTGTCAATCCGGACCTGGCCCTCAGCGGGAACATCATCTCC
GTCACCTTTGACCTCCCTCATGCGCTCAGATATTGTGAGGACGGCGATTGGCATCTCAAGCCCCGTCGCGGTCAG
TCGGCTCTTTTGGACGCTCTGGCCTATCTCTCGTCCGACGCAACGGCCTGGAGTCACACCGTCGTCGCTTGGACG
GGCGAGATCGAGACTCCCTCTGACGAGCTGCGCCTCAGTCGTGAGGCCCGAAAGCGGCTCGAGCATAAGCTCGCT
CGCGGCGGCAATATCCGAGCCGTGCCTGTCTGGCTGGCCGATGATGATGATGACGACGACGACGACGACGACGAC
GACGACGACGATGAAGACGACGCCATCCGTCTACGAGATCAGTCCCGCTGGCGTCGTTACGCTCAACACGAGCTC
TTCGCCCTCCTCCACTACCAGCAGAACGAGCCGACCGACGGGCGACGCGAGCGCGTGCAATGGGCCGACTACTAC
CGCATGAACCAGATCTTCGCCGACCGAGTTCTCCAAGTCTACCGGCCTGGCGACGTCGTCATCGTCCACGACTAT
CCGTTGATGCTACTGCCCAGTATGCTGCGGCGGAAAGCACCGACCATGCACATGTCCTTTTTCCTACACTGCCCG
TTTCCCAGCAGCGAGTTCGTCCGCTGTCTCCCGCGGCGCAAGGAGGTGCTCGAGGGCGTCTTGGGTGCTAACCTG
GTGGGTTTCCAGTCGTACAGCTACTCGCGCCACTTCCTCAGCTGCTGCACCCGCATCCTCGGCTTCCCTTCGGAC
ACTCTGGGCGTCGACGCGTACGGGTCGCGCGTCCAGGTGGGCGTCTTTCCCGTCGGCATCGATACGGCCAAGGTG
GAAGCGCTGGCCTGGCGCGAGCCCGTGGGCGTCAAGCTCGAGGCCCTCAGGGCTCTGTATGCCGGCAAGAAGATC
ATAGTCGGGCGCGACCGGCTCGACAGCGTTCGAGGCGTGGCCCAGAAGCTTCAGGCCTTTGAACGCTTCCTCGAA
CTGTACCCGGCCTGGCGACAGCGCGTCGTCCTCATCCAGGTGACGTCACCAGCCGGCAGCAGTGGCGATGGAGAC
TCGCGCGTCAACGAGCTCGTGGTTCGCATAAACGGACAGTACGGGAGCCTCGACTTTGCGCCCGTTCAGCATTAC
CCGCACTATCTGAGCCAGGACGAGTACTTTGCGCTGCTGCGGGCTGCCGACATCGGACTCATCACGTCTGTGCGC
GACGGCATGAACACCATGAGCTTCGAGTTCGTCGTCTGTCAGAAGCAGGGTCGAGGACCGCTGATGCTGTCCGAG
TTCAGCGGCAGTGCCACCAGCCTGGGCGACGCCATTCACATCAATCCGTGGGACCTTACGGGCGTCGCCGACGGC
ATCCACGCGGCGCTGACCATGGCTGACGAGGCCCGAACCGAGATGCACGACCGGCTTTACTGCCACGTTCGCCGT
CACGATGCCCAGTCGTGGATGACGAGGCTGATACGAAAGGCCTGTAGCGTGCTGGCAGAGGCGACGACGGCCACG
ACTCCTCCCCTGGACGGCGCTCTGCTACTGAGCCGTTACCGGGCCGCGCGCGGGAGGCGGCTATTCATGCTCGAC
TACGACGGCACGCTGACGCCCATCGTTCGCGAGCCCAGCGCGGCTGTGCCTTCGGAACGCGTCGTCGAGGCCCTA
CGACTGCTGGCGGCCGACTCCCGGAACGCCGTCTGGATCATCTCGGGCCGCGATCAGGACTTTCTCGGTCGTCAC
CTCGGTCACATACCGCGCTTGGGCTTCTCGGCCGAGCACGGCAGCTTCGTCCGCCAGCCGGGTGAGGACCGGTGG
AGCAACCTGGCGGAGAAGCTGGACATGGGCTGGCAGGCCGACGTCATGGCCGTGTTTCAGACGTACACGGACAGG
GTTCCCGGCTCCTTCATCGAGCGCAAGCGCTGCGCCCTGACCTGGCACTACCGGCTCGCCGAACCGAACCTCGGG
CCCGAAATGGCGAGAAGGTGTCAGGCCGAACTCGAGGCCGGCGTCGGTCGTCGGTGGGAGGTCGAGGTGATGCCT
GGAAAGGCCAATATCGAGGTTCGGCCGACCATGGTCAACAAGGGGGAGATTGCCAAGCGGCTGGTGGCTACGTAT
CGCGAGTCAGACGGTCTGGACTTTGCCCTCTGCATGGGCGACGACTTTACCGACGAGGACATGTTCCGGACGCTC
AACGGCGCTTCCGGGGCGGTGCTCGGGGCCGACGACGTCTTCACCGTCACCGTCGGGGCCGGGACCAAGGCGACG
CTGGCCAAGTGGCATCTCCTCGAGCCCCAAGACGTCATCGACTGCGTGGCGTTACTCGCGGCCGAGCACGAAACG
GGTCAGGAGCAGACGGGAGGCGTGAACCTGGCGGCGCTGAGTGTGGTTGAGGGACACATTCCACAGGCTTGA
Gene >Ophcf2|05929
ATGACGCGCCGCGAATCGCTCGACGAGCTCCGCGCTGTCAATCCGGACCTGGCCCTCAGCGGGAACATCATCTCC
GTCACCTTTGACCTCCCTCATGCGCTCAGATATTGTGAGGACGGCGATTGGGTACGTCGGAAGGGGGTTTGTTTC
GCCCTTAAGCCGCTGACGGTTACGCAGCATCTCAAGCCCCGTCGCGGTCAGTCGGCTCTTTTGGACGCTCTGGCC
TATCTCTCGTCCGACGCAACGGCCTGGAGTCACACCGTCGTCGCTTGGACGGGCGAGATCGAGACTCCCTCTGAC
GAGCTGCGCCTCAGTCGTGAGGCCCGAAAGCGGCTCGAGCATAAGCTCGCTCGCGGCGGCAATATCCGAGCCGTG
CCTGTCTGGCTGGCCGATGATGATGATGACGACGACGACGACGACGACGACGACGACGACGATGAAGACGACGCC
ATCCGTCTACGAGATCAGTCCCGCTGGCGTCGTTACGCTCAACACGAGCTCTTCGCCCTCCTCCACTACCAGCAG
AACGAGCCGACCGACGGGCGACGCGAGCGCGTGCAATGGGCCGACTACTACCGCATGAACCAGATCTTCGCCGAC
CGAGTTCTCCAAGTCTACCGGCCTGGCGACGTCGTCATCGTCCACGACTATCCGTTGATGCTACTGCCCAGTATG
CTGCGGCGGAAAGCACCGACCATGCACATGTCCTTTTTCCTACACTGCCCGTTTCCCAGCAGCGAGTTCGTCCGC
TGTCTCCCGCGGCGCAAGGAGGTGCTCGAGGGCGTCTTGGGTGCTAACCTGGTGGGTTTCCAGTCGTACAGCTAC
TCGCGCCACTTCCTCAGCTGCTGCACCCGCATCCTCGGCTTCCCTTCGGACACTCTGGGCGTCGACGCGTACGGG
TCGCGCGTCCAGGTGGGCGTCTTTCCCGTCGGCATCGATACGGCCAAGGTGGAAGCGCTGGCCTGGCGCGAGCCC
GTGGGCGTCAAGCTCGAGGCCCTCAGGGCTCTGTATGCCGGCAAGAAGATCATAGTCGGGCGCGACCGGCTCGAC
AGCGTTCGAGGCGTGGCCCAGAAGCTTCAGGCCTTTGAACGCTTCCTCGAACTGTACCCGGCCTGGCGACAGCGC
GTCGTCCTCATCCAGGTGACGTCACCAGCCGGCAGCAGTGGCGATGGAGACTCGCGCGTCAACGAGCTCGTGGTT
CGCATAAACGGACAGTACGGGAGCCTCGACTTTGCGCCCGTTCAGCATTACCCGCACTATCTGAGCCAGGACGAG
TACTTTGCGCTGCTGCGGGCTGCCGACATCGGACTCATCACGTCTGTGCGCGACGGCATGAACACCATGAGCTTC
GAGTTCGTCGTCTGTCAGAAGCAGGGTCGAGGACCGCTGATGCTGTCCGAGTTCAGCGGCAGTGCCACCAGCCTG
GGCGACGCCATTCACATCAATCCGTGGGACCTTACGGGCGTCGCCGACGGCATCCACGCGGCGCTGACCATGGCT
GACGAGGCCCGAACCGAGATGCACGACCGGCTTTACTGCCACGTTCGCCGTCACGATGCCCAGTCGTGGATGACG
AGGCTGATACGAAAGGCCTGTAGCGTGCTGGCAGAGGCGACGACGGCCACGACTCCTCCCCTGGACGGCGCTCTG
CTACTGAGCCGTTACCGGGCCGCGCGCGGGAGGCGGCTATTCATGCTCGACTACGACGGCACGCTGACGCCCATC
GTTCGCGAGCCCAGCGCGGCTGTGCCTTCGGAACGCGTCGTCGAGGCCCTACGACTGCTGGCGGCCGACTCCCGG
AACGCCGTCTGGATCATCTCGGGCCGCGATCAGGACTTTCTCGGTCGTCACCTCGGTCACATACCGCGCTTGGGC
TTCTCGGCCGAGCACGGCAGCTTCGTCCGCCAGCCGGGTGAGGACCGGTGGAGCAACCTGGCGGAGAAGCTGGAC
ATGGGCTGGCAGGCCGACGTCATGGCCGTGTTTCAGACGTACACGGACAGGGTTCCCGGTGAGAAAGAGGCGTTT
TCCCCTTTGGCGCCATATCAAAGGCTGACGCGTGACTTCCAGGCTCCTTCATCGAGCGCAAGCGCTGCGCCCTGA
CCTGGCACTACCGGCTCGCCGAACCGAACCTCGGGCCCGAAATGGCGAGAAGGTGTCAGGCCGAACTCGAGGCCG
GCGTCGGTCGTCGGTGGGAGGTCGAGGTGATGCCTGGAAAGGCCAATATCGAGGTTCGGCCGACCATGGTCAACA
AGGGGGAGATTGCCAAGCGGCTGGTGGCTACGTATCGCGAGTCAGACGGTCTGGACTTTGCCCTCTGCATGGGCG
ACGACTTTACCGACGAGGACATGTTCCGGACGCTCAACGGCGCTTCCGGGGCGGTGCTCGGGGCCGACGACGTCT
TCACCGTCACCGTCGGGGCCGGGACCAAGGCGACGCTGGCCAAGTGGCATCTCCTCGAGCCCCAAGACGTCATCG
ACTGCGTGGCGTTACTCGCGGCCGAGCACGAAACGGGTCAGGAGCAGACGGGAGGCGTGAACCTGGCGGCGCTGA
GTGTGGTTGAGGGACACATTCCACAGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail