Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05922
Gene name
Locationscaffold_07:137429..138842
Strand+
Gene length (bp)1413
Transcript length (bp)1299
Coding sequence length (bp)1299
Protein length (aa) 433

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 8.2E-32 21 302

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Peroxisome Peroxisomal targeting signal 0.3489 0.217 0.2938 0.1716 0.4196 0.1806 0.2289 0.0637 0.1466 0.4752

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 21.90 10.55 33.24
Alive In ants, during behavior modification 17.48 7.82 27.13
Dead In ants, recently dead 23.87 11.73 36.01

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.371235 no
Alive Dead 0.119374 no
Dead Fungus 0.747281 no

Orthologs

Orthofinder run ID4
Orthogroup1566
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|05922 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4833
Ophiocordyceps kimflemingae Ophio5|1096
Ophiocordyceps subramaniannii Hirsu2|115
Ophiocordyceps subramaniannii Hirsu2|407

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05922
MTADPASQVQDFYRDRSVFCTGATGMLGLAYIVRLVLETPVGHVYAMARGGEKRMWQVCNDYLPREQVEALQKSD
RITVFDGDITHTNLGLTDDQIETIRDKVSVVVHAASTVNLVKPLHEVADVIIYSSLAVADFVLSLRNLERFVYVS
TAYASTFLRRDMQGNVIGSDAVIKEKVHQLRSIVETAEAELADIRECGTTPEFNFADYLYPYSYAKNLTERLLIS
RFEKHGQSDRLLIFRPSIIGPAEKLPCPNFEIAGSTPVTTFMAAAIMTPPLSMCFASPLEDPTTATIDEVPVDMV
VNRLVVHTAYSSSGPVHAASGRDARVKSETLWLQAIAMRSWWWWRPTGAWTSKDWSAAGVCKLSRLFKVCGCDFV
FDQAKSEAVWARMSQGEQETWPFWPTPADEDKNHVLGRERALRLLCDKFASRTCLPA*
Coding >Ophcf2|05922
ATGACTGCCGATCCTGCCAGCCAAGTCCAGGACTTCTACCGGGACCGCTCCGTCTTCTGCACGGGCGCGACGGGG
ATGCTGGGGTTGGCGTATATCGTGCGGTTGGTGCTGGAGACTCCGGTCGGGCATGTGTATGCCATGGCGAGAGGA
GGAGAGAAGCGCATGTGGCAAGTCTGCAACGATTATCTCCCGCGAGAGCAGGTCGAGGCTCTGCAAAAGTCGGAC
CGCATCACCGTCTTCGATGGCGACATCACGCACACCAACCTCGGCCTCACCGACGACCAGATCGAGACGATACGC
GACAAGGTCTCTGTCGTCGTTCACGCGGCGTCCACCGTCAACCTGGTCAAGCCTCTTCACGAGGTGGCCGACGTC
ATCATCTACTCGTCGCTGGCCGTGGCCGACTTTGTCCTCTCGCTCCGCAACCTCGAGCGATTCGTCTACGTCTCT
ACAGCCTACGCCAGCACCTTTCTGCGGCGTGACATGCAAGGCAACGTGATCGGGTCCGACGCCGTCATCAAGGAG
AAAGTCCATCAGCTTCGCAGCATCGTCGAGACGGCCGAGGCGGAACTGGCCGACATTCGCGAGTGTGGCACAACG
CCCGAATTCAACTTTGCCGATTACCTATATCCTTACAGCTATGCCAAGAACCTGACGGAACGGCTGCTCATCAGT
CGCTTCGAGAAGCACGGCCAGTCTGACAGGCTGCTCATCTTCCGGCCTTCCATCATCGGTCCGGCCGAGAAGCTT
CCCTGTCCCAACTTTGAGATTGCTGGTTCGACGCCCGTGACGACTTTCATGGCTGCTGCCATCATGACGCCCCCT
CTCAGCATGTGCTTCGCCTCCCCCCTCGAGGATCCCACGACAGCGACCATAGACGAAGTCCCCGTCGACATGGTC
GTCAACCGCCTCGTCGTCCACACAGCCTACAGCTCCTCAGGCCCCGTCCACGCCGCTTCCGGCCGCGACGCCCGC
GTCAAGAGCGAGACCCTCTGGCTACAAGCCATAGCCATGCGAAGCTGGTGGTGGTGGCGACCCACGGGAGCGTGG
ACCAGCAAGGATTGGTCCGCCGCCGGCGTCTGCAAGCTCAGCCGTCTCTTCAAGGTCTGCGGTTGCGACTTCGTC
TTCGATCAGGCCAAGTCGGAGGCTGTGTGGGCGCGGATGAGCCAGGGTGAGCAGGAGACGTGGCCTTTTTGGCCT
ACGCCTGCTGATGAGGATAAGAATCATGTTCTTGGGAGGGAGAGAGCGTTGAGGTTGCTCTGCGATAAGTTTGCA
AGTAGGACTTGTCTGCCGGCTTGA
Transcript >Ophcf2|05922
ATGACTGCCGATCCTGCCAGCCAAGTCCAGGACTTCTACCGGGACCGCTCCGTCTTCTGCACGGGCGCGACGGGG
ATGCTGGGGTTGGCGTATATCGTGCGGTTGGTGCTGGAGACTCCGGTCGGGCATGTGTATGCCATGGCGAGAGGA
GGAGAGAAGCGCATGTGGCAAGTCTGCAACGATTATCTCCCGCGAGAGCAGGTCGAGGCTCTGCAAAAGTCGGAC
CGCATCACCGTCTTCGATGGCGACATCACGCACACCAACCTCGGCCTCACCGACGACCAGATCGAGACGATACGC
GACAAGGTCTCTGTCGTCGTTCACGCGGCGTCCACCGTCAACCTGGTCAAGCCTCTTCACGAGGTGGCCGACGTC
ATCATCTACTCGTCGCTGGCCGTGGCCGACTTTGTCCTCTCGCTCCGCAACCTCGAGCGATTCGTCTACGTCTCT
ACAGCCTACGCCAGCACCTTTCTGCGGCGTGACATGCAAGGCAACGTGATCGGGTCCGACGCCGTCATCAAGGAG
AAAGTCCATCAGCTTCGCAGCATCGTCGAGACGGCCGAGGCGGAACTGGCCGACATTCGCGAGTGTGGCACAACG
CCCGAATTCAACTTTGCCGATTACCTATATCCTTACAGCTATGCCAAGAACCTGACGGAACGGCTGCTCATCAGT
CGCTTCGAGAAGCACGGCCAGTCTGACAGGCTGCTCATCTTCCGGCCTTCCATCATCGGTCCGGCCGAGAAGCTT
CCCTGTCCCAACTTTGAGATTGCTGGTTCGACGCCCGTGACGACTTTCATGGCTGCTGCCATCATGACGCCCCCT
CTCAGCATGTGCTTCGCCTCCCCCCTCGAGGATCCCACGACAGCGACCATAGACGAAGTCCCCGTCGACATGGTC
GTCAACCGCCTCGTCGTCCACACAGCCTACAGCTCCTCAGGCCCCGTCCACGCCGCTTCCGGCCGCGACGCCCGC
GTCAAGAGCGAGACCCTCTGGCTACAAGCCATAGCCATGCGAAGCTGGTGGTGGTGGCGACCCACGGGAGCGTGG
ACCAGCAAGGATTGGTCCGCCGCCGGCGTCTGCAAGCTCAGCCGTCTCTTCAAGGTCTGCGGTTGCGACTTCGTC
TTCGATCAGGCCAAGTCGGAGGCTGTGTGGGCGCGGATGAGCCAGGGTGAGCAGGAGACGTGGCCTTTTTGGCCT
ACGCCTGCTGATGAGGATAAGAATCATGTTCTTGGGAGGGAGAGAGCGTTGAGGTTGCTCTGCGATAAGTTTGCA
AGTAGGACTTGTCTGCCGGCTTGA
Gene >Ophcf2|05922
ATGACTGCCGATCCTGCCAGCCAAGTCCAGGACTTCTACCGGGACCGCTCCGTCTTCTGCACGGGCGCGACGGGG
ATGCTGGGGTTGGCGTATATCGTGCGGTTGGTGCTGGAGACTCCGGTCGGGCATGTGTATGCCATGGCGAGAGGA
GGAGAGAAGTGAGTTGCTCCCCGGCTCAGAGGGTAGAAGAGGGAGAGAGGGAGAGAGAGAGAAAGGGAGGGAGAG
AGAGAGACAGACAGACCGACAGACAGACGGCTGACAACAAGTCACAGGCGCATGTGGCAAGTCTGCAACGATTAT
CTCCCGCGAGAGCAGGTCGAGGCTCTGCAAAAGTCGGACCGCATCACCGTCTTCGATGGCGACATCACGCACACC
AACCTCGGCCTCACCGACGACCAGATCGAGACGATACGCGACAAGGTCTCTGTCGTCGTTCACGCGGCGTCCACC
GTCAACCTGGTCAAGCCTCTTCACGAGGTGGCCGACGTCATCATCTACTCGTCGCTGGCCGTGGCCGACTTTGTC
CTCTCGCTCCGCAACCTCGAGCGATTCGTCTACGTCTCTACAGCCTACGCCAGCACCTTTCTGCGGCGTGACATG
CAAGGCAACGTGATCGGGTCCGACGCCGTCATCAAGGAGAAAGTCCATCAGCTTCGCAGCATCGTCGAGACGGCC
GAGGCGGAACTGGCCGACATTCGCGAGTGTGGCACAACGCCCGAATTCAACTTTGCCGATTACCTATATCCTTAC
AGCTATGCCAAGAACCTGACGGAACGGCTGCTCATCAGTCGCTTCGAGAAGCACGGCCAGTCTGACAGGCTGCTC
ATCTTCCGGCCTTCCATCATCGGTCCGGCCGAGAAGCTTCCCTGTCCCAACTTTGAGATTGCTGGTTCGACGCCC
GTGACGACTTTCATGGCTGCTGCCATCATGACGCCCCCTCTCAGCATGTGCTTCGCCTCCCCCCTCGAGGATCCC
ACGACAGCGACCATAGACGAAGTCCCCGTCGACATGGTCGTCAACCGCCTCGTCGTCCACACAGCCTACAGCTCC
TCAGGCCCCGTCCACGCCGCTTCCGGCCGCGACGCCCGCGTCAAGAGCGAGACCCTCTGGCTACAAGCCATAGCC
ATGCGAAGCTGGTGGTGGTGGCGACCCACGGGAGCGTGGACCAGCAAGGATTGGTCCGCCGCCGGCGTCTGCAAG
CTCAGCCGTCTCTTCAAGGTCTGCGGTTGCGACTTCGTCTTCGATCAGGCCAAGTCGGAGGCTGTGTGGGCGCGG
ATGAGCCAGGGTGAGCAGGAGACGTGGCCTTTTTGGCCTACGCCTGCTGATGAGGATAAGAATCATGTTCTTGGG
AGGGAGAGAGCGTTGAGGTTGCTCTGCGATAAGTTTGCAAGTAGGACTTGTCTGCCGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail