Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05920
Gene name
Locationscaffold_07:131125..133528
Strand+
Gene length (bp)2403
Transcript length (bp)2232
Coding sequence length (bp)2232
Protein length (aa) 744

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20163 DUF6536 Family of unknown function (DUF6536) 8.9E-54 65 214

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 67 89 22
2 475 497 22
3 509 531 22
4 546 568 22
5 609 631 22
6 651 673 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05920
MAADLSVEAVELDSRPFPVQGDSKEKVESFRASQFAPRSLLSSWFPSIDDDETKSWRIWISRRSRALMLQITIVC
LIMALNLIFTVFTVARYGSEKGIGLIYQGDCETVKKLNQSLHFVINLLSTGMLSASNYCMQLQAAPTRANVDAAH
AQGRWMDIGIPSLRNLRYLTRHRLLTWGLLALSSVPVHLIYNSAVFQSLSSSSYAVAVVKDSFLRGSPWDLTAAD
LRAAGDPAWDESRVSPDYIDYPRVIQDLQQTAATYRRLNVSSCFDVYNDYWKPQGNAIILVANETVQSPPDDSLL
MYAYIVPRWDDWGKNMWALGNGTRRFVAQYSSHAVTKWYLGPQSYQVAGCLVQDPDGIRPTCRFQYSPPIMITIC
IMNLVKVGVMLWSWRTRNSKGPNTGDHQPLYTLGDAIASFMRRPDDTTAGMCLATKDDFLRRRPDKWKPWKSVAP
SPETGPRVYRKQSRLWMEAASLRRWTILLMLCVCTIAAGGPLLATAISNLNHRNILTDLSSLSALGFGATTPLTF
LVTRLPRQDPAGLISSVLLANLPQLLISVIYMLYNAMLSTFLVQREFSLMYKREKHKPLRVSEPIGIQRSSYFIS
LPLRYGVPLYATSGLMHFLLSQSLFMARVTVFSPDGTVDTRASFSSCAYSPMAIMTTMVMGAALVAAIVAMGFRR
YDGTMRMVGTNSRAISAACHVLEEDRAEGFLLPVQWGVVLQSGGVGRCALTTAAVDEVREPREGMEYR*
Coding >Ophcf2|05920
ATGGCAGCAGATCTGTCCGTTGAAGCCGTGGAGCTGGACTCCCGTCCTTTTCCAGTACAAGGGGATAGCAAAGAA
AAGGTCGAGAGCTTCCGTGCCAGCCAATTCGCCCCGCGATCTCTCCTCTCCAGCTGGTTTCCCAGTATCGACGAC
GACGAAACCAAGTCATGGCGAATCTGGATCTCTCGACGGTCTCGCGCGCTGATGCTGCAAATTACAATCGTCTGC
CTCATCATGGCCTTGAACCTGATCTTCACCGTCTTCACCGTGGCCAGGTACGGCAGCGAAAAGGGCATCGGTCTC
ATATACCAGGGAGACTGCGAGACCGTCAAGAAACTCAACCAGTCGCTCCATTTCGTCATAAACCTTCTCAGCACC
GGCATGCTCAGCGCGAGCAACTACTGCATGCAGTTGCAGGCTGCCCCTACCAGAGCAAACGTCGATGCCGCTCAC
GCGCAGGGCAGGTGGATGGATATCGGAATCCCCAGCTTGCGGAACCTCAGGTATCTGACACGTCATCGCCTTTTG
ACCTGGGGCCTCCTCGCGCTGAGCTCCGTCCCCGTTCACTTGATCTACAACTCGGCCGTCTTCCAATCCTTATCG
TCGAGCAGCTATGCCGTCGCCGTCGTCAAAGACTCCTTTCTGCGTGGCAGCCCCTGGGACTTGACCGCCGCAGAT
TTGCGTGCCGCCGGCGACCCGGCCTGGGACGAGTCTCGCGTCAGTCCAGACTACATCGACTACCCGCGTGTCATC
CAAGACTTGCAGCAGACCGCGGCTACGTATCGACGACTCAACGTCTCGTCCTGCTTCGACGTCTACAACGATTAC
TGGAAACCGCAGGGTAACGCCATCATCCTGGTAGCCAACGAGACAGTCCAGAGCCCGCCAGACGACAGCCTCCTC
ATGTACGCCTACATTGTGCCACGATGGGATGACTGGGGCAAGAACATGTGGGCGCTGGGAAACGGCACGAGACGC
TTCGTGGCGCAATATTCGTCACATGCGGTGACAAAATGGTATCTCGGACCGCAAAGTTACCAGGTGGCAGGCTGT
CTGGTGCAAGATCCGGATGGGATCCGACCCACCTGTCGTTTTCAGTACTCACCTCCCATCATGATCACCATCTGC
ATCATGAATCTAGTCAAGGTGGGCGTCATGCTGTGGTCGTGGAGGACGAGGAACAGCAAGGGCCCCAATACGGGC
GACCATCAGCCCCTATACACGCTCGGAGACGCCATTGCGTCCTTTATGCGAAGACCTGACGATACGACGGCTGGC
ATGTGCCTGGCCACAAAGGATGACTTCCTGAGGCGACGTCCCGACAAATGGAAGCCGTGGAAGTCGGTCGCGCCT
AGCCCGGAGACCGGTCCGAGAGTGTATCGGAAGCAGTCGCGGCTGTGGATGGAAGCTGCTAGCTTGAGACGATGG
ACGATCTTGTTGATGCTATGCGTGTGCACGATTGCCGCCGGAGGACCTCTGCTAGCCACGGCAATATCGAACCTA
AATCATCGCAACATACTCACGGACCTGAGCAGCCTCTCGGCGCTCGGCTTCGGGGCCACGACGCCCTTGACGTTT
CTCGTGACGAGGCTGCCCCGTCAAGACCCAGCCGGCCTCATCTCGAGCGTGCTGCTGGCCAACCTGCCGCAGCTG
CTCATCTCCGTCATCTACATGCTCTACAACGCCATGCTGAGCACCTTTCTCGTCCAGCGCGAGTTCAGTCTCATG
TACAAGAGGGAGAAGCACAAGCCGCTTCGGGTTTCGGAGCCCATCGGGATACAGAGGTCGAGCTACTTCATCTCG
TTGCCGCTGAGGTACGGCGTGCCGCTGTACGCGACGTCGGGGCTGATGCACTTTCTGCTGAGCCAGAGCCTGTTC
ATGGCCAGGGTCACTGTCTTTTCTCCCGACGGCACCGTCGACACGAGGGCGTCGTTTTCGTCGTGCGCCTACAGC
CCCATGGCCATCATGACGACGATGGTTATGGGAGCGGCTCTGGTTGCCGCCATCGTCGCAATGGGGTTTCGCCGA
TACGACGGCACCATGAGGATGGTGGGCACCAACAGCCGGGCCATCAGCGCAGCGTGCCACGTCTTGGAAGAGGAT
CGCGCCGAGGGTTTCCTCTTGCCGGTGCAGTGGGGAGTCGTTTTGCAGTCTGGCGGCGTGGGGAGATGCGCCTTA
ACGACGGCAGCCGTTGACGAGGTCAGAGAGCCTAGGGAAGGGATGGAGTATCGGTAG
Transcript >Ophcf2|05920
ATGGCAGCAGATCTGTCCGTTGAAGCCGTGGAGCTGGACTCCCGTCCTTTTCCAGTACAAGGGGATAGCAAAGAA
AAGGTCGAGAGCTTCCGTGCCAGCCAATTCGCCCCGCGATCTCTCCTCTCCAGCTGGTTTCCCAGTATCGACGAC
GACGAAACCAAGTCATGGCGAATCTGGATCTCTCGACGGTCTCGCGCGCTGATGCTGCAAATTACAATCGTCTGC
CTCATCATGGCCTTGAACCTGATCTTCACCGTCTTCACCGTGGCCAGGTACGGCAGCGAAAAGGGCATCGGTCTC
ATATACCAGGGAGACTGCGAGACCGTCAAGAAACTCAACCAGTCGCTCCATTTCGTCATAAACCTTCTCAGCACC
GGCATGCTCAGCGCGAGCAACTACTGCATGCAGTTGCAGGCTGCCCCTACCAGAGCAAACGTCGATGCCGCTCAC
GCGCAGGGCAGGTGGATGGATATCGGAATCCCCAGCTTGCGGAACCTCAGGTATCTGACACGTCATCGCCTTTTG
ACCTGGGGCCTCCTCGCGCTGAGCTCCGTCCCCGTTCACTTGATCTACAACTCGGCCGTCTTCCAATCCTTATCG
TCGAGCAGCTATGCCGTCGCCGTCGTCAAAGACTCCTTTCTGCGTGGCAGCCCCTGGGACTTGACCGCCGCAGAT
TTGCGTGCCGCCGGCGACCCGGCCTGGGACGAGTCTCGCGTCAGTCCAGACTACATCGACTACCCGCGTGTCATC
CAAGACTTGCAGCAGACCGCGGCTACGTATCGACGACTCAACGTCTCGTCCTGCTTCGACGTCTACAACGATTAC
TGGAAACCGCAGGGTAACGCCATCATCCTGGTAGCCAACGAGACAGTCCAGAGCCCGCCAGACGACAGCCTCCTC
ATGTACGCCTACATTGTGCCACGATGGGATGACTGGGGCAAGAACATGTGGGCGCTGGGAAACGGCACGAGACGC
TTCGTGGCGCAATATTCGTCACATGCGGTGACAAAATGGTATCTCGGACCGCAAAGTTACCAGGTGGCAGGCTGT
CTGGTGCAAGATCCGGATGGGATCCGACCCACCTGTCGTTTTCAGTACTCACCTCCCATCATGATCACCATCTGC
ATCATGAATCTAGTCAAGGTGGGCGTCATGCTGTGGTCGTGGAGGACGAGGAACAGCAAGGGCCCCAATACGGGC
GACCATCAGCCCCTATACACGCTCGGAGACGCCATTGCGTCCTTTATGCGAAGACCTGACGATACGACGGCTGGC
ATGTGCCTGGCCACAAAGGATGACTTCCTGAGGCGACGTCCCGACAAATGGAAGCCGTGGAAGTCGGTCGCGCCT
AGCCCGGAGACCGGTCCGAGAGTGTATCGGAAGCAGTCGCGGCTGTGGATGGAAGCTGCTAGCTTGAGACGATGG
ACGATCTTGTTGATGCTATGCGTGTGCACGATTGCCGCCGGAGGACCTCTGCTAGCCACGGCAATATCGAACCTA
AATCATCGCAACATACTCACGGACCTGAGCAGCCTCTCGGCGCTCGGCTTCGGGGCCACGACGCCCTTGACGTTT
CTCGTGACGAGGCTGCCCCGTCAAGACCCAGCCGGCCTCATCTCGAGCGTGCTGCTGGCCAACCTGCCGCAGCTG
CTCATCTCCGTCATCTACATGCTCTACAACGCCATGCTGAGCACCTTTCTCGTCCAGCGCGAGTTCAGTCTCATG
TACAAGAGGGAGAAGCACAAGCCGCTTCGGGTTTCGGAGCCCATCGGGATACAGAGGTCGAGCTACTTCATCTCG
TTGCCGCTGAGGTACGGCGTGCCGCTGTACGCGACGTCGGGGCTGATGCACTTTCTGCTGAGCCAGAGCCTGTTC
ATGGCCAGGGTCACTGTCTTTTCTCCCGACGGCACCGTCGACACGAGGGCGTCGTTTTCGTCGTGCGCCTACAGC
CCCATGGCCATCATGACGACGATGGTTATGGGAGCGGCTCTGGTTGCCGCCATCGTCGCAATGGGGTTTCGCCGA
TACGACGGCACCATGAGGATGGTGGGCACCAACAGCCGGGCCATCAGCGCAGCGTGCCACGTCTTGGAAGAGGAT
CGCGCCGAGGGTTTCCTCTTGCCGGTGCAGTGGGGAGTCGTTTTGCAGTCTGGCGGCGTGGGGAGATGCGCCTTA
ACGACGGCAGCCGTTGACGAGGTCAGAGAGCCTAGGGAAGGGATGGAGTATCGGTAG
Gene >Ophcf2|05920
ATGGCAGCAGATCTGTCCGTTGAAGCCGTGGAGCTGGACTCCCGTCCTTTTCCAGTACAAGGGGATAGCAAAGAA
AAGGTCGAGAGCTTCCGTGCCAGCCAATTCGCCCCGCGATCTCTCCTCTCCAGCTGGTTTCCCAGTATCGACGAC
GACGAAACCAAGTCATGGCGAATCTGGATCTCTCGACGGTCTCGCGCGCTGATGCTGCAAATTACAATCGTCTGC
CTCATCATGGCCTTGAACCTGATCTTCACCGTCTTCACCGTGGCCAGGTACGGCAGCGAAAAGGGCATCGGTCTC
ATATACCAGGGAGACTGCGAGACCGTCAAGAAACTCAACCAGTCGCTCCATTTCGTCATAAACCTTCTCAGCACC
GGCATGCTCAGCGCGAGCAACTACTGCATGCAGTTGCAGGCTGCCCCTACCAGAGCAAACGTCGATGCCGCTCAC
GCGCAGGGCAGGTGGATGGATATCGGAATCCCCAGCTTGCGGAACCTCAGGTATCTGACACGTCATCGCCTTTTG
ACCTGGGGCCTCCTCGCGCTGAGCTCCGTCCCCGTTCACTTGATGTGAGTTGTCCGTGACTCCAAGCGGCCAATG
TTGTTGACAGTCATGACGACCAGCTACAACTCGGCCGTCTTCCAATCCTTATCGTCGAGCAGCTATGCCGTCGCC
GTCGTCAAAGACTCCTTTCTGCGTGGCAGCCCCTGGGACTTGACCGCCGCAGATTTGCGTGCCGCCGGCGACCCG
GCCTGGGACGAGTCTCGCGTCAGTCCAGACTACATCGACTACCCGCGTGTCATCCAAGACTTGCAGCAGACCGCG
GCTACGTATCGACGACTCAACGTCTCGTCCTGCTTCGACGTCTACAACGATTACTGGAAACCGCAGGGTAACGCC
ATCATCCTGGTAGCCAACGAGACAGTCCAGAGCCCGCCAGACGACAGCCTCCTCATGTACGCCTACATTGTGCCA
CGATGGGATGACTGGGGCAAGAACATGTGGGCGCTGGGAAACGGCACGAGACGCTTCGTGGCGCAATATTCGTCA
CATGCGGTGACAAAATGGTATCTCGGACCGCAAAGTTACCAGGTGGCAGGCTGTCTGGTGCAAGATCCGGATGGG
ATCCGACCCACCTGTCGTTTTCAGTACTCACCTCCCATCATGATCACCATCTGCATCATGAATCTAGTCAAGGTG
GGCGTCATGCTGTGGTCGTGGAGGACGAGGAACAGCAAGGGCCCCAATACGGGCGACCATCAGCCCCTATACACG
CTCGGAGACGCCATTGCGTCCTTTATGCGAAGACCTGACGATACGACGGCTGGCATGTGCCTGGCCACAAAGGAT
GACTTCCTGAGGCGACGTCCCGACAAATGGAAGCCGTGGAAGTCGGTCGCGCCTAGCCCGGAGACCGGTCCGAGA
GTGTATCGGAAGCAGTCGCGGCTGTGGATGGAAGCTGCTAGCTTGAGACGATGGACGATCTTGTTGATGCTGTGA
GTCGGGATCGTGAAGCCTACCGAGGATATCCGCGTCCTAACGACGACTTTGCCATCGTCTAGATGCGTGTGCACG
ATTGCCGCCGGAGGACCTCTGCTAGCCACGGCAATATCGAACCTAAATCATCGCAACATACTCACGGACCTGAGC
AGCCTCTCGGCGCTCGGCTTCGGGGCCACGACGCCCTTGACGTTTCTCGTGACGAGGCTGCCCCGTCAAGACCCA
GCCGGCCTCATCTCGAGCGTGCTGCTGGCCAACCTGCCGCAGCTGCTCATCTCCGTCATCTACATGCTCTACAAC
GCCATGCTGAGCACCTTTCTCGTCCAGCGCGAGTTCAGTCTCATGTACAAGAGGGAGAAGCACAAGCCGCTTCGG
GTTTCGGAGCCCATCGGGATACAGAGGTCGAGCTACTTCATCTCGTTGCCGCTGAGGTACGGCGTGCCGCTGTAC
GCGACGTCGGGGCTGATGCACTTTCTGCTGAGCCAGAGCCTGTTCATGGCCAGGGTCACTGTCTTTTCTCCCGAC
GGCACCGTCGACACGAGGGCGTCGTTTTCGTCGTGCGCCTACAGCCCCATGGCCATCATGACGAGTAGGTCAACC
GCCGGGCGCGGGTACCCAATGTCTAACGCCTTCTTCGCAGCGATGGTTATGGGAGCGGCTCTGGTTGCCGCCATC
GTCGCAATGGGGTTTCGCCGATACGACGGCACCATGAGGATGGTGGGCACCAACAGCCGGGCCATCAGCGCAGCG
TGCCACGTCTTGGAAGAGGATCGCGCCGAGGGTTTCCTCTTGCCGGTGCAGTGGGGAGTCGTTTTGCAGTCTGGC
GGCGTGGGGAGATGCGCCTTAACGACGGCAGCCGTTGACGAGGTCAGAGAGCCTAGGGAAGGGATGGAGTATCGG
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail