Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05915
Gene name
Locationscaffold_07:121678..123325
Strand+
Gene length (bp)1647
Transcript length (bp)1476
Coding sequence length (bp)1476
Protein length (aa) 492

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 1.2E-23 9 375
PF00890 FAD_binding_2 FAD binding domain 7.8E-06 11 41
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.9E-05 13 42

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 394 416 22
3 451 482 31

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 99.67 56.55 142.80
Alive In ants, during behavior modification 93.76 53.04 134.48
Dead In ants, recently dead 78.21 44.82 111.60

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.792717 no
Alive Dead 0.291041 no
Dead Fungus 0.210301 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05915
MELKTTSRLRVIIVGAGIGGLTAALALNRAGIDFIIVEKHASVLEPMGSSITLTPGSQRILHQLGILNKIKTLSR
PYSRDVEVRGPNGQVLSQVSLSSFAIMHGEGIIILQRDLLIRTLYEALPAESEFFLGRSVVSVEHEAGGVRVHLS
DGLSETGHLVVGSDGVRGVVRGAMWKHADAMSPGLITRDDGEAVWCSWRCLWATCAEDERVTNDVIMSSHDNRSC
TTVLSPLGSLTLGVMVKTGSAGRRSNRLPTYKAEETEKMAASVAHLPLNESLTFGHLWAKKLRGGMTDIEVGVLN
RWHYGRIVLVGDTAHSITPAMTSGANLCMESVVELVNALHQAVVDAGNQVPTGTDLERALSRYQERQLPRAMTVC
RLSMLYDRLHAWDATWMRLWSLYLARWLNPLLVPLFLGYIFRGSPLLDFVPVEGWPRGTWSWVHGHEEMERGNWR
WAVGGVAVVVLIVLGWALGVVGGEFALILLLFRRLWLFSWG*
Coding >Ophcf2|05915
ATGGAACTCAAAACTACCAGCCGACTTCGTGTCATCATCGTGGGAGCCGGCATCGGCGGCCTCACCGCGGCACTC
GCACTGAATCGGGCCGGCATTGACTTTATCATCGTTGAGAAGCACGCGTCGGTGCTCGAGCCGATGGGCTCCTCC
ATCACCTTGACTCCCGGATCGCAGAGGATCCTGCATCAGCTGGGAATCCTGAACAAGATCAAGACACTCTCGCGC
CCCTATTCCCGAGACGTTGAGGTTCGAGGACCAAACGGTCAGGTGCTGTCTCAAGTCTCCTTGTCGAGCTTTGCC
ATCATGCATGGAGAAGGCATCATAATTCTGCAGCGTGATTTGCTCATCAGAACGCTGTACGAGGCGCTACCCGCC
GAATCCGAGTTTTTCTTGGGCAGGTCGGTTGTGTCAGTCGAGCACGAAGCAGGAGGCGTCCGCGTTCATCTCTCG
GACGGACTCTCGGAGACGGGTCATCTGGTGGTGGGCTCCGACGGTGTCAGGGGCGTCGTCCGGGGCGCCATGTGG
AAACACGCCGATGCCATGTCTCCGGGACTCATCACTCGAGATGATGGAGAAGCGGTGTGGTGCAGTTGGAGGTGT
CTCTGGGCCACTTGCGCGGAAGACGAACGGGTGACAAACGACGTCATCATGAGTAGCCATGACAACCGGTCGTGC
ACAACCGTCCTCTCCCCCCTGGGAAGTCTGACACTGGGCGTAATGGTCAAGACGGGCTCGGCCGGACGACGAAGT
AATCGGCTGCCTACATACAAGGCCGAGGAGACGGAGAAGATGGCGGCGTCGGTTGCACATCTGCCTCTCAACGAG
AGCCTGACGTTTGGCCATCTCTGGGCTAAGAAGCTTCGAGGAGGCATGACGGATATCGAAGTGGGCGTCTTGAAC
CGCTGGCATTACGGACGCATCGTCCTCGTCGGCGATACAGCCCACAGCATAACGCCAGCCATGACATCTGGCGCC
AACTTGTGCATGGAAAGCGTCGTCGAGCTCGTCAACGCCCTTCACCAGGCCGTCGTCGATGCAGGGAACCAGGTG
CCGACCGGGACCGATCTCGAGAGGGCGCTCAGCCGATACCAGGAACGTCAGCTCCCGCGTGCCATGACGGTGTGC
CGCCTGTCGATGCTGTACGACCGGCTGCACGCGTGGGACGCGACGTGGATGAGGCTATGGTCGCTTTACCTCGCT
CGCTGGCTGAACCCGCTGCTGGTTCCGCTCTTCCTGGGCTACATCTTCCGTGGGAGTCCGCTGTTGGACTTTGTG
CCTGTCGAGGGCTGGCCGAGGGGGACCTGGTCTTGGGTTCATGGCCACGAGGAGATGGAGAGGGGAAATTGGCGG
TGGGCTGTTGGGGGGGTTGCGGTGGTTGTGCTTATCGTTCTCGGGTGGGCTTTGGGGGTTGTTGGGGGGGAGTTT
GCCCTCATCTTGTTGCTATTTCGACGGCTATGGCTGTTTTCGTGGGGGTGA
Transcript >Ophcf2|05915
ATGGAACTCAAAACTACCAGCCGACTTCGTGTCATCATCGTGGGAGCCGGCATCGGCGGCCTCACCGCGGCACTC
GCACTGAATCGGGCCGGCATTGACTTTATCATCGTTGAGAAGCACGCGTCGGTGCTCGAGCCGATGGGCTCCTCC
ATCACCTTGACTCCCGGATCGCAGAGGATCCTGCATCAGCTGGGAATCCTGAACAAGATCAAGACACTCTCGCGC
CCCTATTCCCGAGACGTTGAGGTTCGAGGACCAAACGGTCAGGTGCTGTCTCAAGTCTCCTTGTCGAGCTTTGCC
ATCATGCATGGAGAAGGCATCATAATTCTGCAGCGTGATTTGCTCATCAGAACGCTGTACGAGGCGCTACCCGCC
GAATCCGAGTTTTTCTTGGGCAGGTCGGTTGTGTCAGTCGAGCACGAAGCAGGAGGCGTCCGCGTTCATCTCTCG
GACGGACTCTCGGAGACGGGTCATCTGGTGGTGGGCTCCGACGGTGTCAGGGGCGTCGTCCGGGGCGCCATGTGG
AAACACGCCGATGCCATGTCTCCGGGACTCATCACTCGAGATGATGGAGAAGCGGTGTGGTGCAGTTGGAGGTGT
CTCTGGGCCACTTGCGCGGAAGACGAACGGGTGACAAACGACGTCATCATGAGTAGCCATGACAACCGGTCGTGC
ACAACCGTCCTCTCCCCCCTGGGAAGTCTGACACTGGGCGTAATGGTCAAGACGGGCTCGGCCGGACGACGAAGT
AATCGGCTGCCTACATACAAGGCCGAGGAGACGGAGAAGATGGCGGCGTCGGTTGCACATCTGCCTCTCAACGAG
AGCCTGACGTTTGGCCATCTCTGGGCTAAGAAGCTTCGAGGAGGCATGACGGATATCGAAGTGGGCGTCTTGAAC
CGCTGGCATTACGGACGCATCGTCCTCGTCGGCGATACAGCCCACAGCATAACGCCAGCCATGACATCTGGCGCC
AACTTGTGCATGGAAAGCGTCGTCGAGCTCGTCAACGCCCTTCACCAGGCCGTCGTCGATGCAGGGAACCAGGTG
CCGACCGGGACCGATCTCGAGAGGGCGCTCAGCCGATACCAGGAACGTCAGCTCCCGCGTGCCATGACGGTGTGC
CGCCTGTCGATGCTGTACGACCGGCTGCACGCGTGGGACGCGACGTGGATGAGGCTATGGTCGCTTTACCTCGCT
CGCTGGCTGAACCCGCTGCTGGTTCCGCTCTTCCTGGGCTACATCTTCCGTGGGAGTCCGCTGTTGGACTTTGTG
CCTGTCGAGGGCTGGCCGAGGGGGACCTGGTCTTGGGTTCATGGCCACGAGGAGATGGAGAGGGGAAATTGGCGG
TGGGCTGTTGGGGGGGTTGCGGTGGTTGTGCTTATCGTTCTCGGGTGGGCTTTGGGGGTTGTTGGGGGGGAGTTT
GCCCTCATCTTGTTGCTATTTCGACGGCTATGGCTGTTTTCGTGGGGGTGA
Gene >Ophcf2|05915
ATGGAACTCAAAACTACCAGCCGACTTCGTGTCATCATCGTGGGAGCCGGCATCGGCGGCCTCACCGCGGCACTC
GCACTGAATCGGGCCGGCATTGACTTTATCATCGTTGAGAAGCACGCGTCGGTGCTCGAGCCGATGGGCTCCTCC
ATCACCTTGACTCCCGGATCGCAGAGGATCCTGCATCAGCTGGGAATCCTGAACAAGATCAAGACACTCTCGCGC
CCCTATTCCCGAGACGTTGAGGTTCGAGGACCAAACGGTCAGGTGCTGTCTCAAGTCTCCTTGTCGAGCTTTGCC
ATCATGTGAGAGCGGGCCTTACCCACCCCAAAATCAGCGGGTGCAATCTCTTTAACAAGGTTGGCAAAGGCATGG
AGAAGGCATCATAATTCTGCAGCGTGATTTGCTCATCAGAACGCTGTACGAGGCGCTACCCGCCGAATCCGAGTT
TTTCTTGGGCAGGTCGGTTGTGTCAGTCGAGCACGAAGCAGGAGGCGTCCGCGTTCATCTCTCGGACGGACTCTC
GGAGACGGGTCATCTGGTGGTGGGCTCCGACGGTGTCAGGGGCGTCGTCCGGGGCGCCATGTGGAAACACGCCGA
TGCCATGTCTCCGGGACTCATCACTCGAGATGATGGAGAAGGTGAGCGGCCACTTTGGTAGTTGTTGACGCCTGC
TCACAGTTTTGCAGCGGTGTGGTGCAGTTGGAGGTGTCTCTGGGCCACTTGCGCGGAAGACGAACGGGTGACAAA
CGACGTCATCATGAGTAGCCATGACAACCGGTCGTGCACAACCGTCCTCTCCCCCCTGGGAAGTCTGACACTGGG
CGTAATGGTCAAGACGGGCTCGGCCGGACGACGAAGTAATCGGCTGCCTACATACAAGGCCGAGGAGACGGAGAA
GATGGCGGCGTCGGTTGCACATCTGCCTCTCAACGAGAGCCTGACGTTTGGCCATCTCTGGGCTAAGAAGCTTCG
AGGAGGCATGACGGATATCGAAGTGGGCGTCTTGAACCGCTGGCATTACGGACGCATCGTCCTCGTCGGCGATAC
AGCCCACAGCGTGAGTTGCGAAAACAAGAAGTTGTACTTGGTTGCATCAGCATCTGACGGGCTGAGCAGATAACG
CCAGCCATGACATCTGGCGCCAACTTGTGCATGGAAAGCGTCGTCGAGCTCGTCAACGCCCTTCACCAGGCCGTC
GTCGATGCAGGGAACCAGGTGCCGACCGGGACCGATCTCGAGAGGGCGCTCAGCCGATACCAGGAACGTCAGCTC
CCGCGTGCCATGACGGTGTGCCGCCTGTCGATGCTGTACGACCGGCTGCACGCGTGGGACGCGACGTGGATGAGG
CTATGGTCGCTTTACCTCGCTCGCTGGCTGAACCCGCTGCTGGTTCCGCTCTTCCTGGGCTACATCTTCCGTGGG
AGTCCGCTGTTGGACTTTGTGCCTGTCGAGGGCTGGCCGAGGGGGACCTGGTCTTGGGTTCATGGCCACGAGGAG
ATGGAGAGGGGAAATTGGCGGTGGGCTGTTGGGGGGGTTGCGGTGGTTGTGCTTATCGTTCTCGGGTGGGCTTTG
GGGGTTGTTGGGGGGGAGTTTGCCCTCATCTTGTTGCTATTTCGACGGCTATGGCTGTTTTCGTGGGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail