Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05912
Gene name
Locationscaffold_07:116928..118458
Strand-
Gene length (bp)1530
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 133 155 22
2 215 234 19
3 249 271 22
4 300 322 22
5 326 345 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 51.24 29.03 73.45
Alive In ants, during behavior modification 39.98 22.16 57.80
Dead In ants, recently dead 43.53 24.32 62.74

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.215087 no
Alive Dead 0.660724 no
Dead Fungus 0.435435 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05912
MTLQEQQCIHEGRCASMADGGGVLGRDTGEEGFKVEDAVVAVANDGDGDDDEDDDDDDDDDDDDDDRDEDDQDES
NDDKSTRVRLTRSSPSSPFRLPPATRLENNLPFAVGLLELANAGDFAANVWNQIPVPLYAMILMALGGTLALIMS
IVALYDVRRAWANVRFLRSQRRKLHRRRRRLPSSALDSSFWSASLLAMSFRELWSEVINRLAMDGLMGAGALLIA
TGTYMAMGGGDESVFNVSNILSGYLGNTPLALFALVNSSWAMFLAWTAQSHVRAVGRRCLSPATVQLVTRRSRCV
QIFSAVNGSAAVVGGVGSMLTATKWWAYLLLAPVVISSIFCNVWWRRRVGYTRSRARLSSATSLESHLEFASWAA
KTIRECKKKERNPPLTTIITGSATDDTAHLLRWFRRHDLLPDFCVRLLAYPILYDALVSDPQAKELVLDINDLLA
LPSALHPRLRDVADECFAAVGVEHFRHRVRHLAELLGTYCTVAARAPSDEEVAEKEMGS*
Coding >Ophcf2|05912
ATGACGCTACAGGAGCAGCAGTGCATCCACGAAGGGCGCTGCGCCTCCATGGCAGACGGGGGGGGTGTGCTGGGT
CGAGACACGGGGGAGGAGGGCTTCAAGGTGGAGGATGCGGTTGTTGCTGTTGCGAATGACGGGGATGGCGACGAC
GACGAAGACGACGACGACGACGACGATGACGATGACGACGATGACGACCGAGACGAAGACGACCAAGATGAATCC
AACGACGATAAATCAACCCGCGTCCGCCTCACCCGATCCTCCCCATCCTCACCCTTCCGCCTCCCCCCAGCAACC
CGCCTAGAAAACAACCTCCCCTTCGCCGTCGGCCTCCTCGAGCTCGCCAACGCGGGCGACTTCGCGGCCAACGTA
TGGAACCAAATCCCCGTCCCCCTCTACGCCATGATCCTAATGGCCCTCGGCGGAACCCTCGCCCTGATAATGAGC
ATCGTCGCCCTCTACGACGTCCGCCGCGCCTGGGCCAACGTCCGCTTCCTACGAAGCCAGCGCCGGAAACTTCAT
CGCCGACGCAGACGCCTCCCTTCTTCCGCGCTTGATTCGAGCTTCTGGTCGGCTTCGCTTTTGGCAATGTCCTTT
CGTGAGCTTTGGAGCGAGGTCATCAATAGGCTCGCTATGGATGGCCTCATGGGTGCCGGCGCTCTGCTCATCGCT
ACGGGCACGTACATGGCCATGGGGGGAGGCGACGAAAGCGTCTTCAACGTAAGCAACATCCTATCCGGATACCTG
GGCAACACCCCCCTCGCCCTCTTCGCCCTCGTCAACTCCTCGTGGGCCATGTTCCTCGCCTGGACCGCACAGTCG
CACGTCCGCGCCGTTGGAAGACGATGCCTCTCCCCCGCTACCGTCCAGCTCGTCACCCGACGAAGCCGCTGCGTG
CAAATCTTCTCCGCCGTCAATGGTTCCGCCGCTGTTGTTGGGGGCGTGGGCTCTATGCTGACGGCTACCAAGTGG
TGGGCCTACCTTCTTCTCGCCCCCGTCGTCATCTCCAGCATCTTCTGCAACGTCTGGTGGAGGAGGAGAGTAGGA
TATACCCGTTCACGAGCGCGTCTCTCGTCCGCGACCTCTCTAGAATCCCACCTCGAATTCGCCTCCTGGGCCGCA
AAAACCATCCGAGAATGCAAGAAGAAAGAACGAAACCCCCCCCTAACAACCATCATCACCGGCTCCGCAACAGAC
GACACAGCCCACCTCCTCCGCTGGTTCCGCCGCCACGACCTCCTCCCCGATTTCTGCGTCCGTCTCCTCGCCTAC
CCCATCCTCTACGATGCGCTCGTCTCCGATCCCCAGGCGAAAGAACTCGTCCTCGACATAAACGATTTACTGGCG
CTTCCGTCTGCACTGCATCCGCGGTTGCGTGACGTGGCGGACGAGTGCTTCGCTGCCGTCGGGGTGGAACATTTC
CGTCATCGGGTGAGGCATCTTGCCGAGTTGCTGGGGACGTATTGCACTGTTGCTGCGAGGGCGCCTTCGGATGAG
GAGGTTGCCGAAAAGGAGATGGGTAGTTGA
Transcript >Ophcf2|05912
ATGACGCTACAGGAGCAGCAGTGCATCCACGAAGGGCGCTGCGCCTCCATGGCAGACGGGGGGGGTGTGCTGGGT
CGAGACACGGGGGAGGAGGGCTTCAAGGTGGAGGATGCGGTTGTTGCTGTTGCGAATGACGGGGATGGCGACGAC
GACGAAGACGACGACGACGACGACGATGACGATGACGACGATGACGACCGAGACGAAGACGACCAAGATGAATCC
AACGACGATAAATCAACCCGCGTCCGCCTCACCCGATCCTCCCCATCCTCACCCTTCCGCCTCCCCCCAGCAACC
CGCCTAGAAAACAACCTCCCCTTCGCCGTCGGCCTCCTCGAGCTCGCCAACGCGGGCGACTTCGCGGCCAACGTA
TGGAACCAAATCCCCGTCCCCCTCTACGCCATGATCCTAATGGCCCTCGGCGGAACCCTCGCCCTGATAATGAGC
ATCGTCGCCCTCTACGACGTCCGCCGCGCCTGGGCCAACGTCCGCTTCCTACGAAGCCAGCGCCGGAAACTTCAT
CGCCGACGCAGACGCCTCCCTTCTTCCGCGCTTGATTCGAGCTTCTGGTCGGCTTCGCTTTTGGCAATGTCCTTT
CGTGAGCTTTGGAGCGAGGTCATCAATAGGCTCGCTATGGATGGCCTCATGGGTGCCGGCGCTCTGCTCATCGCT
ACGGGCACGTACATGGCCATGGGGGGAGGCGACGAAAGCGTCTTCAACGTAAGCAACATCCTATCCGGATACCTG
GGCAACACCCCCCTCGCCCTCTTCGCCCTCGTCAACTCCTCGTGGGCCATGTTCCTCGCCTGGACCGCACAGTCG
CACGTCCGCGCCGTTGGAAGACGATGCCTCTCCCCCGCTACCGTCCAGCTCGTCACCCGACGAAGCCGCTGCGTG
CAAATCTTCTCCGCCGTCAATGGTTCCGCCGCTGTTGTTGGGGGCGTGGGCTCTATGCTGACGGCTACCAAGTGG
TGGGCCTACCTTCTTCTCGCCCCCGTCGTCATCTCCAGCATCTTCTGCAACGTCTGGTGGAGGAGGAGAGTAGGA
TATACCCGTTCACGAGCGCGTCTCTCGTCCGCGACCTCTCTAGAATCCCACCTCGAATTCGCCTCCTGGGCCGCA
AAAACCATCCGAGAATGCAAGAAGAAAGAACGAAACCCCCCCCTAACAACCATCATCACCGGCTCCGCAACAGAC
GACACAGCCCACCTCCTCCGCTGGTTCCGCCGCCACGACCTCCTCCCCGATTTCTGCGTCCGTCTCCTCGCCTAC
CCCATCCTCTACGATGCGCTCGTCTCCGATCCCCAGGCGAAAGAACTCGTCCTCGACATAAACGATTTACTGGCG
CTTCCGTCTGCACTGCATCCGCGGTTGCGTGACGTGGCGGACGAGTGCTTCGCTGCCGTCGGGGTGGAACATTTC
CGTCATCGGGTGAGGCATCTTGCCGAGTTGCTGGGGACGTATTGCACTGTTGCTGCGAGGGCGCCTTCGGATGAG
GAGGTTGCCGAAAAGGAGATGGGTAGTTGA
Gene >Ophcf2|05912
ATGACGCTACAGGAGCAGCAGTGCATCCACGAAGGGCGCTGCGCCTCCATGGCAGACGGGGGGGGTGTGCTGGGT
CGAGACACGGGGGAGGAGGGCTTCAAGGTGGAGGATGCGGTTGTTGCTGTTGCGAATGACGGGGATGGCGACGAC
GACGAAGACGACGACGACGACGACGATGACGATGACGACGATGACGACCGAGACGAAGACGACCAAGATGAATCC
AACGACGATAAATCAACCCGCGTCCGCCTCACCCGATCCTCCCCATCCTCACCCTTCCGCCTCCCCCCAGCAACC
CGCCTAGAAAACAACCTCCCCTTCGCCGTCGGCCTCCTCGAGCTCGCCAACGCGGGCGACTTCGCGGCCAACGTA
TGGAACCAAATCCCCGTCCCCCTCTACGCCATGATCCTAATGGCCCTCGGCGGAACCCTCGCCCTGATAATGAGC
ATCGTCGCCCTCTACGACGTCCGCCGCGCCTGGGCCAACGTCCGCTTCCTACGAAGCCAGCGCCGGAAACTTCAT
CGCCGACGCAGACGCCTCCCTTCTTCCGCGCTTGATTCGAGCTTCTGGTCGGCTTCGCTTTTGGCAATGTCCTTT
CGTGAGCTTTGGAGCGAGGTCATCAATAGGCTCGCTATGGATGGCCTCATGGGTGCCGGCGCTCTGCTCATCGCT
ACGGGCACGTACATGGCCATGGGGGGAGGCGACGAAAGCGTCTTCAACGTAAGCAACATCCTATCCGGATACCTG
GGCAACACCCCCCTCGCCCTCTTCGCCCTCGTCAACTCCTCGTGGGCCATGTTCCTCGCCTGGACCGCACAGTCG
CACGTCCGCGCCGTTGGAAGACGATGCCTCTCCCCCGCTACCGTCCAGCTCGTCACCCGACGAAGCCGCTGCGTG
CAAATCTTCTCCGCCGTCAATGGTTCCGCCGCTGTTGTTGGGGGCGTGGGCTCTATGCTGACGGCTACCAAGTGG
TGGGCCTACCTTCTTCTCGCCCCCGTCGTCATCTCCAGCATCTTCTGCAACGTCTGGTGGAGGAGGAGAGTAGGA
TATACCCGTTCACGAGCGCGTCTCTCGTCCGCGACCTCTCTAGAATCCCACCTCGAATTCGCCTCCTGGGCCGCA
AAAACCATCCGAGAATGCAAGAAGAAAGAACGAAACCCCCCCCTAACAACCATCATCACCGGCTCCGCAACAGAC
GACACAGCCCACCTCCTCCGCTGGTTCCGCCGCCACGACCTCCTCCCCGATTTCTGCGTCCGTCTCCTCGCCTAC
CCCATCCTCTACGATGCGCTCGTCTCCGATCCCCAGGCGAAAGAACTCGTCCTCGACATAAACGATTTACTGGCG
CTTCCGTCTGCACTGCATCCGCGGTTGCGTGACGTGGCGGACGAGTGCTTCGCTGCCGTCGGGGTGGAACATTTC
CGTCATCGGGTGAGGCATCTTGCCGAGTTGCTGGGGACGTATTGCACTGTTGCTGCGAGGGCGCCTTCGGATGAG
GAGGTTGCCGAAAAGGAGATGGGTAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail