Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05909
Gene name
Locationscaffold_07:107059..109084
Strand-
Gene length (bp)2025
Transcript length (bp)1851
Coding sequence length (bp)1851
Protein length (aa) 617

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.2E-11 49 486

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.5

Transmembrane Domains

Domain # Start End Length
1 130 152 22
2 165 187 22
3 197 219 22
4 269 288 19
5 298 320 22
6 340 362 22
7 377 399 22
8 406 428 22
9 433 455 22
10 476 498 22
11 546 568 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 14.28 6.83 21.73
Alive In ants, during behavior modification 19.99 10.01 29.97
Dead In ants, recently dead 27.36 14.54 40.19

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.135216 no
Alive Dead 0.094549 no
Dead Fungus 0.002117 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05909
MRHLDEQTPLLGRRSKNPEPSSSGVARADAAFASLSPLHRAWLFGGIFLVGCAYGLESQVRATYQPYATSSFSLH
PYLSTINVLRSVVAVAVQPTAAKVADVVGRFEVVAASTACYVVGMAIEASAASVYAFCAGGLVYQVGYTAIVLVL
EVLVADVSSMRARVFFSYVPALPFVVNAWVGGALASAILSVSSWRWGIAMWCLVYPLASLPLLIALYLLDRRRAS
PSTTAAVKSASGGSVTSSGSGSGPDSETRSETPSDSLLQQLDIVGLFGLVAALSLVLAPLTVAGGSEADVSRWRS
PLVLAPLAVGLVLLPLFALWERRGARTPLVPMRLLADRGVWSALAVRGLLNLAWSVQGNYLYTVLVVAFDFSVEA
ATRILSLFSFCGVVSGVVVGMIVYRLRRLKAVIVVGTCLFTAGLAVLYFFPGGAEASSAAGVVTGQVLLGLASGL
FAYPTQASIQASATRDHVAVMTGLYLSLYNIGSALGTSLSGALWSAALPPALSANLAFQPNETLARATYHSPFDV
VARYPVGTAVRTAIVVSYCHVQRLLCLAGIVACLPMIAFALALRNPRLSKRQVQPDAVAPLPPEPITTTATTTTT
TTTTTTTEDPSTIVDG*
Coding >Ophcf2|05909
ATGCGCCATCTTGACGAGCAGACGCCCCTGCTGGGCCGACGGTCCAAGAATCCAGAACCGTCATCGTCGGGCGTC
GCCCGCGCCGACGCCGCCTTCGCCAGCCTCTCTCCCCTTCATCGAGCCTGGCTCTTCGGCGGCATCTTTCTCGTC
GGTTGCGCCTACGGCCTCGAGAGCCAAGTCCGAGCTACATACCAGCCGTACGCGACGTCCAGCTTCTCGCTGCAT
CCCTACCTGTCAACCATCAACGTTCTGCGCAGCGTCGTCGCCGTCGCCGTTCAGCCGACAGCGGCAAAGGTGGCT
GATGTCGTGGGCCGCTTCGAGGTCGTGGCCGCCTCTACGGCCTGCTATGTGGTCGGCATGGCTATAGAGGCCTCG
GCCGCCTCCGTCTACGCCTTTTGCGCTGGCGGTTTGGTCTATCAGGTCGGCTATACTGCCATCGTTCTCGTTCTC
GAAGTGCTCGTCGCCGACGTCTCGTCCATGCGCGCTCGCGTCTTCTTTAGCTACGTGCCGGCTCTCCCCTTTGTC
GTCAACGCCTGGGTCGGCGGCGCCCTTGCTTCTGCCATCTTGTCCGTCTCGTCGTGGCGCTGGGGCATCGCCATG
TGGTGTCTCGTCTATCCGCTTGCCTCGCTACCGCTTCTCATCGCTCTTTATCTGCTCGACCGTCGTCGCGCGTCC
CCTTCGACCACGGCAGCCGTCAAGTCCGCCTCCGGTGGATCCGTTACTAGCTCCGGCTCCGGTTCCGGGCCCGAC
TCCGAGACCCGCTCCGAGACCCCTTCCGACTCCCTCCTGCAGCAGCTCGATATTGTCGGTCTCTTCGGTCTCGTC
GCCGCCCTTTCTCTAGTCCTGGCGCCTCTGACAGTGGCCGGTGGCAGCGAAGCCGACGTTTCCCGCTGGAGAAGC
CCCCTTGTGCTGGCTCCTCTCGCCGTCGGCCTCGTCCTGCTGCCGCTCTTTGCCCTGTGGGAGCGTCGCGGTGCC
CGGACGCCGCTCGTGCCGATGCGGCTACTGGCCGATCGCGGCGTCTGGTCAGCACTGGCGGTCCGCGGCTTGCTC
AACCTCGCGTGGTCGGTACAGGGCAACTATCTGTACACGGTTCTCGTCGTCGCCTTTGACTTCTCCGTCGAGGCC
GCCACCCGAATCCTCTCCCTCTTCTCCTTCTGTGGCGTCGTCAGCGGCGTCGTCGTCGGCATGATTGTCTATCGT
CTTCGTCGACTCAAGGCCGTCATCGTCGTGGGAACCTGTCTCTTCACCGCCGGCCTCGCCGTCCTCTACTTCTTC
CCCGGAGGCGCCGAAGCGTCGTCGGCAGCCGGCGTCGTGACCGGTCAGGTCCTCCTCGGCCTCGCCAGCGGCCTC
TTCGCCTACCCGACTCAGGCGTCGATCCAAGCATCAGCAACTCGCGACCACGTGGCCGTCATGACAGGTCTCTAT
CTCTCCCTCTACAACATCGGCTCCGCGCTCGGCACCAGCCTCTCAGGCGCCCTCTGGTCCGCCGCCCTTCCGCCA
GCCCTCTCGGCGAATCTGGCTTTTCAGCCCAACGAGACATTGGCTCGTGCCACATACCACTCCCCCTTTGACGTA
GTCGCCCGTTACCCTGTCGGGACTGCCGTTCGTACCGCCATCGTCGTCAGCTACTGTCATGTTCAGCGCCTTCTC
TGCCTCGCCGGCATCGTCGCTTGTCTTCCCATGATTGCCTTTGCACTGGCCCTGAGGAATCCGCGCCTGTCGAAG
CGGCAGGTTCAGCCGGATGCTGTGGCCCCGCTGCCGCCGGAGCCGATAACGACGACGGCGACGACGACGACGACG
ACGACGACGACGACGACGACCGAAGATCCTTCTACCATCGTGGACGGCTGA
Transcript >Ophcf2|05909
ATGCGCCATCTTGACGAGCAGACGCCCCTGCTGGGCCGACGGTCCAAGAATCCAGAACCGTCATCGTCGGGCGTC
GCCCGCGCCGACGCCGCCTTCGCCAGCCTCTCTCCCCTTCATCGAGCCTGGCTCTTCGGCGGCATCTTTCTCGTC
GGTTGCGCCTACGGCCTCGAGAGCCAAGTCCGAGCTACATACCAGCCGTACGCGACGTCCAGCTTCTCGCTGCAT
CCCTACCTGTCAACCATCAACGTTCTGCGCAGCGTCGTCGCCGTCGCCGTTCAGCCGACAGCGGCAAAGGTGGCT
GATGTCGTGGGCCGCTTCGAGGTCGTGGCCGCCTCTACGGCCTGCTATGTGGTCGGCATGGCTATAGAGGCCTCG
GCCGCCTCCGTCTACGCCTTTTGCGCTGGCGGTTTGGTCTATCAGGTCGGCTATACTGCCATCGTTCTCGTTCTC
GAAGTGCTCGTCGCCGACGTCTCGTCCATGCGCGCTCGCGTCTTCTTTAGCTACGTGCCGGCTCTCCCCTTTGTC
GTCAACGCCTGGGTCGGCGGCGCCCTTGCTTCTGCCATCTTGTCCGTCTCGTCGTGGCGCTGGGGCATCGCCATG
TGGTGTCTCGTCTATCCGCTTGCCTCGCTACCGCTTCTCATCGCTCTTTATCTGCTCGACCGTCGTCGCGCGTCC
CCTTCGACCACGGCAGCCGTCAAGTCCGCCTCCGGTGGATCCGTTACTAGCTCCGGCTCCGGTTCCGGGCCCGAC
TCCGAGACCCGCTCCGAGACCCCTTCCGACTCCCTCCTGCAGCAGCTCGATATTGTCGGTCTCTTCGGTCTCGTC
GCCGCCCTTTCTCTAGTCCTGGCGCCTCTGACAGTGGCCGGTGGCAGCGAAGCCGACGTTTCCCGCTGGAGAAGC
CCCCTTGTGCTGGCTCCTCTCGCCGTCGGCCTCGTCCTGCTGCCGCTCTTTGCCCTGTGGGAGCGTCGCGGTGCC
CGGACGCCGCTCGTGCCGATGCGGCTACTGGCCGATCGCGGCGTCTGGTCAGCACTGGCGGTCCGCGGCTTGCTC
AACCTCGCGTGGTCGGTACAGGGCAACTATCTGTACACGGTTCTCGTCGTCGCCTTTGACTTCTCCGTCGAGGCC
GCCACCCGAATCCTCTCCCTCTTCTCCTTCTGTGGCGTCGTCAGCGGCGTCGTCGTCGGCATGATTGTCTATCGT
CTTCGTCGACTCAAGGCCGTCATCGTCGTGGGAACCTGTCTCTTCACCGCCGGCCTCGCCGTCCTCTACTTCTTC
CCCGGAGGCGCCGAAGCGTCGTCGGCAGCCGGCGTCGTGACCGGTCAGGTCCTCCTCGGCCTCGCCAGCGGCCTC
TTCGCCTACCCGACTCAGGCGTCGATCCAAGCATCAGCAACTCGCGACCACGTGGCCGTCATGACAGGTCTCTAT
CTCTCCCTCTACAACATCGGCTCCGCGCTCGGCACCAGCCTCTCAGGCGCCCTCTGGTCCGCCGCCCTTCCGCCA
GCCCTCTCGGCGAATCTGGCTTTTCAGCCCAACGAGACATTGGCTCGTGCCACATACCACTCCCCCTTTGACGTA
GTCGCCCGTTACCCTGTCGGGACTGCCGTTCGTACCGCCATCGTCGTCAGCTACTGTCATGTTCAGCGCCTTCTC
TGCCTCGCCGGCATCGTCGCTTGTCTTCCCATGATTGCCTTTGCACTGGCCCTGAGGAATCCGCGCCTGTCGAAG
CGGCAGGTTCAGCCGGATGCTGTGGCCCCGCTGCCGCCGGAGCCGATAACGACGACGGCGACGACGACGACGACG
ACGACGACGACGACGACGACCGAAGATCCTTCTACCATCGTGGACGGCTGA
Gene >Ophcf2|05909
ATGCGCCATCTTGACGAGCAGACGCCCCTGCTGGGCCGACGGTCCAAGAATCCAGAACCGTCATCGTCGGGTACG
TCATCAGAATCATCGTCCTCATCATCATCCGAGGACCCATTGTCGATAGCCATATTTCCCGAATCCTCCTCATCA
GACTCATCGTCATCCTCCTCTTCCTCCACCACCACTTCCTCCTCCTCCTCCTCCTCCTCTCTTCTCGCAAATCAT
TCCCTCCAACGCTCCCCAGGCGTCGCCCGCGCCGACGCCGCCTTCGCCAGCCTCTCTCCCCTTCATCGAGCCTGG
CTCTTCGGCGGCATCTTTCTCGTCGGTTGCGCCTACGGCCTCGAGAGCCAAGTCCGAGCTACATACCAGCCGTAC
GCGACGTCCAGCTTCTCGCTGCATCCCTACCTGTCAACCATCAACGTTCTGCGCAGCGTCGTCGCCGTCGCCGTT
CAGCCGACAGCGGCAAAGGTGGCTGATGTCGTGGGCCGCTTCGAGGTCGTGGCCGCCTCTACGGCCTGCTATGTG
GTCGGCATGGCTATAGAGGCCTCGGCCGCCTCCGTCTACGCCTTTTGCGCTGGCGGTTTGGTCTATCAGGTCGGC
TATACTGCCATCGTTCTCGTTCTCGAAGTGCTCGTCGCCGACGTCTCGTCCATGCGCGCTCGCGTCTTCTTTAGC
TACGTGCCGGCTCTCCCCTTTGTCGTCAACGCCTGGGTCGGCGGCGCCCTTGCTTCTGCCATCTTGTCCGTCTCG
TCGTGGCGCTGGGGCATCGCCATGTGGTGTCTCGTCTATCCGCTTGCCTCGCTACCGCTTCTCATCGCTCTTTAT
CTGCTCGACCGTCGTCGCGCGTCCCCTTCGACCACGGCAGCCGTCAAGTCCGCCTCCGGTGGATCCGTTACTAGC
TCCGGCTCCGGTTCCGGGCCCGACTCCGAGACCCGCTCCGAGACCCCTTCCGACTCCCTCCTGCAGCAGCTCGAT
ATTGTCGGTCTCTTCGGTCTCGTCGCCGCCCTTTCTCTAGTCCTGGCGCCTCTGACAGTGGCCGGTGGCAGCGAA
GCCGACGTTTCCCGCTGGAGAAGCCCCCTTGTGCTGGCTCCTCTCGCCGTCGGCCTCGTCCTGCTGCCGCTCTTT
GCCCTGTGGGAGCGTCGCGGTGCCCGGACGCCGCTCGTGCCGATGCGGCTACTGGCCGATCGCGGCGTCTGGTCA
GCACTGGCGGTCCGCGGCTTGCTCAACCTCGCGTGGTCGGTACAGGGCAACTATCTGTACACGGTTCTCGTCGTC
GCCTTTGACTTCTCCGTCGAGGCCGCCACCCGAATCCTCTCCCTCTTCTCCTTCTGTGGCGTCGTCAGCGGCGTC
GTCGTCGGCATGATTGTCTATCGTCTTCGTCGACTCAAGGCCGTCATCGTCGTGGGAACCTGTCTCTTCACCGCC
GGCCTCGCCGTCCTCTACTTCTTCCCCGGAGGCGCCGAAGCGTCGTCGGCAGCCGGCGTCGTGACCGGTCAGGTC
CTCCTCGGCCTCGCCAGCGGCCTCTTCGCCTACCCGACTCAGGCGTCGATCCAAGCATCAGCAACTCGCGACCAC
GTGGCCGTCATGACAGGTCTCTATCTCTCCCTCTACAACATCGGCTCCGCGCTCGGCACCAGCCTCTCAGGCGCC
CTCTGGTCCGCCGCCCTTCCGCCAGCCCTCTCGGCGAATCTGGCTTTTCAGCCCAACGAGACATTGGCTCGTGCC
ACATACCACTCCCCCTTTGACGTAGTCGCCCGTTACCCTGTCGGGACTGCCGTTCGTACCGCCATCGTCGTCAGC
TACTGTCATGTTCAGCGCCTTCTCTGCCTCGCCGGCATCGTCGCTTGTCTTCCCATGATTGCCTTTGCACTGGCC
CTGAGGAATCCGCGCCTGTCGAAGCGGCAGGTTCAGCCGGATGCTGTGGCCCCGCTGCCGCCGGAGCCGATAACG
ACGACGGCGACGACGACGACGACGACGACGACGACGACGACGACCGAAGATCCTTCTACCATCGTGGACGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail