Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05907
Gene name
Locationscaffold_07:99170..103490
Strand-
Gene length (bp)4320
Transcript length (bp)3075
Coding sequence length (bp)3075
Protein length (aa) 1025

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 3.5E-74 514 785
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 5.9E-46 60 208
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 3.3E-23 231 502
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 4.6E-10 960 1015

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 60 82 22
2 143 165 22
3 187 206 19
4 518 540 22
5 560 582 22
6 608 630 22
7 654 676 22
8 718 740 22
9 765 787 22
10 794 816 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05907
MTEPLDALPDANLGRWLLKRGLLDIFKDSKDPRVGSNRGDSTGPGTISSSNNKTSSLSKLAATFIPVLIFLVICF
LLFSFLRPKCRRVFAPRSIPGLREPQLPSPPLPTGWFNWIIPFYKIPDNFVLNHGSLDGFFFLRFLKVLRNICLG
GCLILWPVLFPIHATGGGGLSELELLTIGNVKDPNRLYAHAVMAWIFFGFVLYMIVRECIYYVNLRQAYLSSPYY
SRRISSRTMLLTCVPKEYLDPRRLRKLYGPSVERIHIPRTTKALANLVQEREQTAARLEKAEVNLILKANKARRK
KLDKTAAKPDGASQESSVTGSLASQHDLVRDRGKMASTRGDHLVLDLPGSYIEFAPSDVKAAAEGVLKEALGHDV
NDDDVGDCDDEYTHPYGLDHDLPDVRGSVAARWIPVESRPYHRPLGNFGRRVDTIRWTRNRLRELNLQIYKMRRQ
VRRGDGTALPAAFIEFDSQESAQAAHQVLAHHRPLQMSSRILGIHPGEVLWKSLRMPWWELIVRRFAIMSFVCAA
VIFWSIPSAAIGLVSQINFLSSIVVLSWLKKLPDLVLGFLTGFVPSFALSMWMAAVPGMLRICGAQAGIPSVTMV
ELFVQKAYFAFQVVQVFLITTLTSAASAAFTKILENPIGIKDVLAENLPMASNFYLSYILIQCLASSGATLLQAF
NLIRHHLLARMSVNPRAQYATWRKLPPARWGGIFPVFANMGVIALSYACIAPLILIFAAGGMMAMQFVWRYNIIY
VFDSGLDSKGLFYPHALLHLTVGLYLAEICLIGLFALHLAFGPLAMMIIFLLFTGLVHVSLMQAIMPLLQNLPQT
LALEAEIQQEDKVAAERAKLQATARTDGEGGPTGAASSYYDPEQAFGEEGARVDHDDDEDEEEEEDEDEATTTND
RALEGASGVKAALGEWFKSSTRSKFQEQAESLGMTKMMDSFRQWMGQKKSDGSPGFLARWLHPEEYEDFIALRRL
IPPDSLPNIEYPDDHKYCDYLPPETWMPKPTLWIPRDEARHYRLRYLRY*
Coding >Ophcf2|05907
ATGACGGAGCCGCTTGACGCCCTCCCTGACGCCAACCTGGGCCGCTGGCTCCTCAAACGCGGCCTCCTCGACATC
TTCAAGGATAGCAAAGACCCCCGCGTCGGTTCTAATCGCGGCGATTCCACCGGCCCAGGCACTATCAGCTCCTCC
AACAACAAGACTTCGTCTCTCAGCAAGCTCGCCGCCACCTTTATTCCCGTCCTCATCTTTCTCGTCATCTGCTTC
CTGCTCTTCTCCTTCCTCCGCCCGAAATGTCGTCGCGTCTTTGCTCCGCGCTCCATCCCTGGTCTCCGCGAGCCT
CAGCTGCCGAGTCCCCCTTTACCAACCGGGTGGTTCAACTGGATCATCCCGTTTTATAAGATTCCAGATAACTTT
GTCCTCAATCACGGCTCGCTCGACGGTTTCTTCTTCCTCCGCTTCCTCAAGGTCTTGAGAAACATCTGCCTTGGT
GGCTGTCTCATTCTATGGCCCGTTCTCTTCCCCATCCACGCCACCGGCGGAGGCGGCCTCTCCGAGCTCGAACTC
TTGACCATTGGCAATGTCAAGGATCCGAATAGGCTGTATGCCCATGCCGTCATGGCCTGGATCTTCTTCGGCTTC
GTTCTCTACATGATTGTCCGCGAATGCATCTACTACGTCAATCTGCGTCAAGCCTATCTCTCTTCGCCTTACTAT
TCGCGCCGCATCTCGTCGAGGACCATGCTTCTGACATGCGTGCCAAAAGAGTACCTCGACCCGCGCCGTCTGCGT
AAACTGTACGGCCCCTCGGTCGAGCGCATACACATACCGCGCACCACAAAGGCATTGGCCAATCTGGTCCAAGAG
CGCGAGCAGACAGCGGCGAGGCTCGAAAAGGCAGAGGTCAATCTGATACTCAAAGCAAACAAGGCTCGCCGCAAG
AAACTCGACAAGACAGCCGCCAAGCCTGATGGAGCGTCGCAGGAGTCTTCTGTGACGGGTTCTTTGGCCTCGCAA
CACGATCTTGTCCGGGATCGCGGAAAGATGGCATCTACTCGCGGCGACCATCTCGTCCTAGACCTGCCCGGATCC
TACATCGAATTTGCGCCCTCGGACGTAAAGGCGGCCGCCGAGGGCGTGCTGAAAGAGGCCCTCGGCCATGACGTC
AACGACGACGACGTGGGAGACTGCGACGACGAATACACTCACCCCTACGGACTTGACCATGATCTTCCAGATGTC
AGGGGCTCCGTCGCCGCCAGATGGATTCCTGTCGAATCGCGGCCCTACCACCGGCCGTTGGGAAACTTTGGCCGT
CGCGTCGACACCATACGCTGGACGAGGAACCGGTTGCGGGAACTCAACCTCCAGATCTACAAGATGCGCCGTCAG
GTTCGAAGGGGCGACGGTACCGCGCTTCCGGCCGCCTTCATCGAGTTCGACAGCCAGGAGAGCGCACAGGCGGCT
CACCAGGTTCTCGCCCACCATCGGCCGCTTCAGATGTCGTCACGTATCCTCGGCATCCACCCAGGTGAGGTGCTG
TGGAAGTCGCTGCGTATGCCCTGGTGGGAACTTATCGTGCGCCGGTTTGCCATCATGTCCTTTGTCTGCGCCGCC
GTCATATTCTGGTCGATTCCTTCGGCCGCAATCGGCCTGGTCTCGCAGATCAACTTTCTGTCCAGTATCGTGGTC
CTCTCGTGGCTCAAGAAGCTGCCGGACCTGGTTCTCGGCTTCCTCACCGGCTTCGTTCCCTCGTTTGCCTTGTCC
ATGTGGATGGCTGCCGTCCCCGGCATGCTGCGAATCTGTGGTGCCCAAGCCGGCATCCCCTCAGTCACCATGGTC
GAACTGTTTGTCCAAAAGGCCTATTTCGCCTTTCAGGTCGTCCAGGTTTTCCTCATCACGACGCTCACGTCGGCT
GCCTCGGCCGCCTTTACCAAGATACTCGAGAATCCAATCGGCATCAAGGACGTACTCGCCGAGAACCTGCCAATG
GCCTCCAACTTCTACCTCTCTTACATTCTTATCCAGTGTCTCGCCAGCAGCGGCGCGACACTGCTGCAGGCATTC
AATCTGATACGGCACCACTTACTGGCCAGGATGTCGGTTAATCCCCGAGCGCAGTACGCGACGTGGCGAAAGCTC
CCGCCGGCGCGCTGGGGCGGCATCTTCCCTGTCTTTGCCAACATGGGCGTCATCGCCCTGAGCTACGCCTGCATT
GCTCCCTTGATCCTCATCTTCGCCGCCGGCGGCATGATGGCGATGCAGTTCGTGTGGCGATACAACATAATCTAC
GTCTTCGACTCGGGATTGGACAGCAAGGGCCTGTTCTATCCACACGCCCTGCTGCACCTCACCGTCGGCCTCTAC
CTGGCTGAAATCTGTCTCATCGGGCTGTTCGCCCTCCACTTGGCGTTTGGGCCCCTCGCCATGATGATCATATTC
CTCCTCTTTACAGGACTGGTGCACGTTTCACTCATGCAAGCCATCATGCCGCTTCTGCAGAACCTGCCTCAGACG
CTGGCACTGGAAGCCGAGATCCAACAGGAGGACAAGGTCGCTGCGGAGAGGGCCAAGCTTCAGGCCACGGCCAGG
ACCGACGGCGAGGGCGGACCGACGGGGGCCGCGAGCAGCTACTACGATCCGGAACAGGCATTCGGCGAGGAGGGA
GCGAGGGTCGACCACGACGACGATGAGGACGAGGAAGAAGAGGAGGACGAGGACGAAGCGACGACGACCAACGAC
CGGGCTCTCGAGGGCGCCAGCGGCGTCAAGGCTGCACTCGGTGAATGGTTCAAGTCGAGCACGCGATCCAAGTTC
CAGGAGCAGGCCGAGAGCCTAGGGATGACCAAGATGATGGACAGCTTTCGGCAGTGGATGGGTCAGAAGAAGAGC
GACGGGTCGCCGGGCTTTCTGGCCAGGTGGCTGCACCCGGAGGAGTACGAGGACTTTATCGCGCTGCGGAGGTTG
ATACCGCCCGACAGCCTGCCCAACATTGAATATCCGGACGATCACAAGTACTGCGACTACCTGCCGCCGGAGACG
TGGATGCCCAAGCCGACGCTCTGGATTCCGCGGGACGAGGCGCGGCATTACCGCTTACGCTACCTCCGTTACTAG
Transcript >Ophcf2|05907
ATGACGGAGCCGCTTGACGCCCTCCCTGACGCCAACCTGGGCCGCTGGCTCCTCAAACGCGGCCTCCTCGACATC
TTCAAGGATAGCAAAGACCCCCGCGTCGGTTCTAATCGCGGCGATTCCACCGGCCCAGGCACTATCAGCTCCTCC
AACAACAAGACTTCGTCTCTCAGCAAGCTCGCCGCCACCTTTATTCCCGTCCTCATCTTTCTCGTCATCTGCTTC
CTGCTCTTCTCCTTCCTCCGCCCGAAATGTCGTCGCGTCTTTGCTCCGCGCTCCATCCCTGGTCTCCGCGAGCCT
CAGCTGCCGAGTCCCCCTTTACCAACCGGGTGGTTCAACTGGATCATCCCGTTTTATAAGATTCCAGATAACTTT
GTCCTCAATCACGGCTCGCTCGACGGTTTCTTCTTCCTCCGCTTCCTCAAGGTCTTGAGAAACATCTGCCTTGGT
GGCTGTCTCATTCTATGGCCCGTTCTCTTCCCCATCCACGCCACCGGCGGAGGCGGCCTCTCCGAGCTCGAACTC
TTGACCATTGGCAATGTCAAGGATCCGAATAGGCTGTATGCCCATGCCGTCATGGCCTGGATCTTCTTCGGCTTC
GTTCTCTACATGATTGTCCGCGAATGCATCTACTACGTCAATCTGCGTCAAGCCTATCTCTCTTCGCCTTACTAT
TCGCGCCGCATCTCGTCGAGGACCATGCTTCTGACATGCGTGCCAAAAGAGTACCTCGACCCGCGCCGTCTGCGT
AAACTGTACGGCCCCTCGGTCGAGCGCATACACATACCGCGCACCACAAAGGCATTGGCCAATCTGGTCCAAGAG
CGCGAGCAGACAGCGGCGAGGCTCGAAAAGGCAGAGGTCAATCTGATACTCAAAGCAAACAAGGCTCGCCGCAAG
AAACTCGACAAGACAGCCGCCAAGCCTGATGGAGCGTCGCAGGAGTCTTCTGTGACGGGTTCTTTGGCCTCGCAA
CACGATCTTGTCCGGGATCGCGGAAAGATGGCATCTACTCGCGGCGACCATCTCGTCCTAGACCTGCCCGGATCC
TACATCGAATTTGCGCCCTCGGACGTAAAGGCGGCCGCCGAGGGCGTGCTGAAAGAGGCCCTCGGCCATGACGTC
AACGACGACGACGTGGGAGACTGCGACGACGAATACACTCACCCCTACGGACTTGACCATGATCTTCCAGATGTC
AGGGGCTCCGTCGCCGCCAGATGGATTCCTGTCGAATCGCGGCCCTACCACCGGCCGTTGGGAAACTTTGGCCGT
CGCGTCGACACCATACGCTGGACGAGGAACCGGTTGCGGGAACTCAACCTCCAGATCTACAAGATGCGCCGTCAG
GTTCGAAGGGGCGACGGTACCGCGCTTCCGGCCGCCTTCATCGAGTTCGACAGCCAGGAGAGCGCACAGGCGGCT
CACCAGGTTCTCGCCCACCATCGGCCGCTTCAGATGTCGTCACGTATCCTCGGCATCCACCCAGGTGAGGTGCTG
TGGAAGTCGCTGCGTATGCCCTGGTGGGAACTTATCGTGCGCCGGTTTGCCATCATGTCCTTTGTCTGCGCCGCC
GTCATATTCTGGTCGATTCCTTCGGCCGCAATCGGCCTGGTCTCGCAGATCAACTTTCTGTCCAGTATCGTGGTC
CTCTCGTGGCTCAAGAAGCTGCCGGACCTGGTTCTCGGCTTCCTCACCGGCTTCGTTCCCTCGTTTGCCTTGTCC
ATGTGGATGGCTGCCGTCCCCGGCATGCTGCGAATCTGTGGTGCCCAAGCCGGCATCCCCTCAGTCACCATGGTC
GAACTGTTTGTCCAAAAGGCCTATTTCGCCTTTCAGGTCGTCCAGGTTTTCCTCATCACGACGCTCACGTCGGCT
GCCTCGGCCGCCTTTACCAAGATACTCGAGAATCCAATCGGCATCAAGGACGTACTCGCCGAGAACCTGCCAATG
GCCTCCAACTTCTACCTCTCTTACATTCTTATCCAGTGTCTCGCCAGCAGCGGCGCGACACTGCTGCAGGCATTC
AATCTGATACGGCACCACTTACTGGCCAGGATGTCGGTTAATCCCCGAGCGCAGTACGCGACGTGGCGAAAGCTC
CCGCCGGCGCGCTGGGGCGGCATCTTCCCTGTCTTTGCCAACATGGGCGTCATCGCCCTGAGCTACGCCTGCATT
GCTCCCTTGATCCTCATCTTCGCCGCCGGCGGCATGATGGCGATGCAGTTCGTGTGGCGATACAACATAATCTAC
GTCTTCGACTCGGGATTGGACAGCAAGGGCCTGTTCTATCCACACGCCCTGCTGCACCTCACCGTCGGCCTCTAC
CTGGCTGAAATCTGTCTCATCGGGCTGTTCGCCCTCCACTTGGCGTTTGGGCCCCTCGCCATGATGATCATATTC
CTCCTCTTTACAGGACTGGTGCACGTTTCACTCATGCAAGCCATCATGCCGCTTCTGCAGAACCTGCCTCAGACG
CTGGCACTGGAAGCCGAGATCCAACAGGAGGACAAGGTCGCTGCGGAGAGGGCCAAGCTTCAGGCCACGGCCAGG
ACCGACGGCGAGGGCGGACCGACGGGGGCCGCGAGCAGCTACTACGATCCGGAACAGGCATTCGGCGAGGAGGGA
GCGAGGGTCGACCACGACGACGATGAGGACGAGGAAGAAGAGGAGGACGAGGACGAAGCGACGACGACCAACGAC
CGGGCTCTCGAGGGCGCCAGCGGCGTCAAGGCTGCACTCGGTGAATGGTTCAAGTCGAGCACGCGATCCAAGTTC
CAGGAGCAGGCCGAGAGCCTAGGGATGACCAAGATGATGGACAGCTTTCGGCAGTGGATGGGTCAGAAGAAGAGC
GACGGGTCGCCGGGCTTTCTGGCCAGGTGGCTGCACCCGGAGGAGTACGAGGACTTTATCGCGCTGCGGAGGTTG
ATACCGCCCGACAGCCTGCCCAACATTGAATATCCGGACGATCACAAGTACTGCGACTACCTGCCGCCGGAGACG
TGGATGCCCAAGCCGACGCTCTGGATTCCGCGGGACGAGGCGCGGCATTACCGCTTACGCTACCTCCGTTACTAG
Gene >Ophcf2|05907
ATGACGGAGCCGCTTGACGCCCTCCCTGACGCCAACCTGGGCCGCTGGCTCCTCAAACGCGGCCTCCTCGACATC
TTCGTTCGTCGCTCTTCTTACTCTGATGCTCTGCTCGTCAAGTCTCGCTCACACGTTGGCTGTAGAAGGATAGCA
AAGACCCCCGCGTCGGTTCTAATCGCGGCGATTCCACCGGCCCAGGCACTATCAGCTCCTCCAACAACAAGACTT
CGTCTCTCAGCAAGCTCGCCGCCACCTTTATTCCCGTCCTCATCTTTCTCGTCATCTGCTTCCTGCTCTTCTCCT
TCCTCCGCCCGAAATGTCGTCGCGTCTTTGCTCCGCGCTCCATCCCTGGTCTCCGCGAGCCTCAGTCGGTACCCT
CACGCCTCTGTCATGTCTTGCAAAGTGCTCACCTTCCTTTGCAGGCTGCCGAGTCCCCCTTTACCAACCGGGTGG
TTCAACTGGATCATCCCGTTTTATAAGATTCCAGATAACTTTGTCCTCAATCACGGCTCGCTCGACGGTTTCTTC
TTCCTCCGCTTCCTCAAGGTCTTGAGAAACATCTGCCTTGGTGGCTGTCTCATTCTATGGCCCGTTCTCTTCCCC
ATCCACGCCACCGGCGGAGGCGGCCTCTCCGAGCTCGAACTCTTGACCATTGGCAATGTCAAGGATCCGAATAGG
CTGTATGCCCATGCCGTCATGGCCTGGATCTTCTTCGGTACCGTTTTGCTGCCCCCTTTTTGAGTCTTGATGACT
TACCCGTGACATGTCAGGCTTCGTTCTCTACATGATTGTCCGCGAATGCATCTACTACGTCAATCTGCGTCAAGC
CTATCTCTCTTCGCCTTACTATTCGCGCCGCATCTCGTCGAGGACCATGCTTCTGACATGCGTGCCAAAAGAGTA
CCTCGACCCGCGCCGTCTGCGTAAACTGTACGGCCCCTCGGTCGAGCGCATACACATACCGCGCACCACAAAGGC
ATTGGCCAATCTGGTCCAAGAGCGCGAGCAGACAGCGGCGAGGCTCGAAAAGGCAGAGGTCAATCTGATACTCAA
AGCAAACAAGGCTCGCCGCAAGAAACTCGACAAGACAGCCGCCAAGCCTGATGGAGCGTCGCAGGAGTCTTCTGT
GACGGGTTCTTTGGCCTCGCAACACGATCTTGTCCGGGATCGCGGAAAGATGGCATCTACTCGCGGCGACCATCT
CGTCCTAGACCTGCCCGGATCCTACATCGAATTTGCGCCCTCGGACGTAAAGGCGGCCGCCGAGGGCGTGCTGAA
AGAGGCCCTCGGCCATGACGTCAACGACGACGACGTGGGAGACTGCGACGACGAATACACTCACCCCTACGGACT
TGACCATGATCTTCCAGATGTCAGGGGCTCCGTCGCCGCCAGATGGATTCCTGTCGAATCGCGGCCCTACCACCG
GCCGTTGGGAAACTTTGGCCGTCGCGTCGACACCATACGCTGGACGAGGAACCGGTTGCGGGAACTCAACCTCCA
GATCTACAAGATGCGCCGTCAGGTTCGAAGGGGCGACGGTACCGCGCTTCCGGCCGCCTTCATCGAGTTCGACAG
CCAGGAGAGCGCACAGGCGGCTCACCAGGTTCTCGCCCACCATCGGCCGCTTCAGATGTCGTCACGTATCCTCGG
CATCCACCCAGGTGAGGTGCTGTGGAAGTCGCTGCGTATGCCCTGGTGGGAACTTATCGTGCGCCGGTTTGCCAT
CATGTCCTTTGTCTGCGCCGCCGTCATATTCTGGTCGATTCCTTCGGCCGCAATCGGCCTGGTCTCGCAGATCAA
CTTTCTGTCCAGTATCGTGGTCCTCTCGTGGCTCAAGAAGCTGCCGGACCTGGTTCTCGGCTTCCTCACCGGCTT
CGTTCCCTCGTTTGCCTTGTCCATGTGGATGGCTGCCGTCCCCGGCATGCTGCGAAGTGCGAATGTCCCGTTGCA
TCTGTTCGTGATTCGCGTCCGCTGACGGTGATATAGTCTGTGGTGCCCAAGCCGGCATCCCCTCAGTCACCATGG
TCGAACTGTTTGTCCAAAAGGCCTATTTCGCCTTTCAGGTCGTCCAGGTTTTCCTCATCACGACGCTCACGTCGG
CTGCCTCGGCCGCCTTTACCAAGATACTCGAGAATCCAATCGGCATCAAGGACGTACTCGCCGAGAACCTGCCAA
TGGCCTCCAACTTCTACCTCTCTTACATTCTTATCCAGTGTCTCGCCAGCAGCGGCGCGACACTGCTGCAGGCAT
TCAATCTGATACGGCACCACTTACTGGCCAGGATGTCGGTTAATCCCCGAGCGCAGTACGCGACGTGGCGAAAGC
TCCCGCCGGCGCGCTGGGGCGGCATCTTCCCTGTCTTTGCCAACATGGGCGTCATCGGTGAGTCCTGTCCCACAT
GCCGGTATGCTGCGAGGCAGGCGACCTAACGCTGTGCAGCCCTGAGCTACGCCTGCATTGCTCCCTTGATCCTCA
TCTTCGCCGCCGGCGGCATGATGGCGATGCAGTTCGTGTGGCGATACAACATAATCTACGTCTTCGACTCGGGAT
TGGACAGCAAGGGCCTGTTCTATCCACACGCCCTGCTGCACCTCACCGTCGGCCTCTACCTGGCTGAAATCTGTC
TCATCGGGCTGTTCGCCCTCCACTTGGCGTTTGGGCCCCTCGCCATGATGATCATATTCCTCCTCTTTACAGGAC
TGGTGCACGTTTCACTCATGCAAGCCATCATGCCGCTTCTGCAGAACCTGCCTCAGACGCTGGCACTGGAAGCCG
AGATCCAACAGGAGGACAAGGTCGCTGCGGAGAGGGCCAAGCTTCAGGCCACGGCCAGGACCGACGGCGAGGGCG
GACCGACGGGGGCCGCGAGCAGCTACTACGATCCGGAACAGGCATTCGGCGAGGAGGGAGCGAGGGTCGACCACG
ACGACGATGAGGACGAGGAAGAAGAGGAGGACGAGGACGAAGCGACGACGACCAACGACCGGGCTCTCGAGGGCG
CCAGCGGCGTCAAGGCTGCACTCGGTGAATGGTTCAAGTCGAGCACGCGATCCAAGTTCCAGGAGCAGGCCGAGA
GCCTAGGGATGACCAAGATGATGGACAGCTTTCGGCAGTGGATGGGTCAGAAGAAGAGCGACGGGTCGCCGGGCT
TTCTGGCCAGGTGGCTGCACCCGGAGGAGTACGAGGACTTTATCGCGCTGCGGAGGTTGATACCGCCCGACAGCC
TGCCCAACATTGAATATCCGGACGATCACAAGTACTGCGACTACCTGCCGCCGGAGACGTGGATGCCCAAGCCGA
CGCTCTGGATTCCGCGGGACGAGGCGCGGGTGAGCCGTCAGGAGGTGGCGCACTCGAGGAAGTACACGCCCATAT
CGGATATTGGGGCGTCGTTGGATGAGAAGGGGCACATATATACATGTTTTGATCAAGCGCCGTTTGATAGGTCTA
AGGTTATTATATAGACGAGGGGTAGATGGGTTGAAGAATAAAGATGTAATATCAAATGGGACCGATATACCGTTG
AGGTTGCATACATATATATGCATGTACGAATATGCATGTGCAGCTATTCGTACCTGGAAAGTGTCAGACAGCTAT
GAGCAGATGCGGTAGGTATTATAGCGGAGTGAAATAGTGATTGTGTGGCATAGAGCAGAGAGATGTAGAGAGGTA
CGAAGAGAGTTATGATCTTAATTGTCCTGTCTTTCTAAGGGGGAGAATCTAATCCTTTCTTATAGCCTAGTCCTT
CTATAGGTATATTCCTAATCATTTCTACTAGGGAGGGCTATCCTAGCTATTGTCTTACGCTAGCTAATTTTCTAA
CACAAGAGAGGGCTATCCTAGCCTATGCCTTATAATAGGTAATTACTCTTTATACCCTATAGCTACTAACATACC
CCCCTAGCTAAGGCACTCTACTTAGCTACCGTAATAGCTTTACTTCGCTTCTATCGAGATCGCTTAATTGTTCTA
GTTACTTCTTCCTACTTCGAATACTATAGAGTAAATAGACTTAAATAAGCCTATTATTCTCTAGCCTTAAATAGC
GTAGCTAGCTACTTATTATTACCTAAGGCATTACTTCTTCTTAAGATAAAAGTAGTAGAGGGCTTAAGATCTTTT
CTCTTCTTACCTTCCTTAAGCTCCTATCTATCGTAAGTAACTCTTTTTCGCTTCTTAGGCTCCTATGCCTATTCG
TCGGATTAACGCTAACCCTATTATACTATAGATAAGCTACTCCCTACCTTTTTCGTAGGAGGAATTAGACTAGCT
AGACATTTCCCTTAGCATTACCGCTTACGCTACCTCCGTTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail