Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05905
Gene name
Locationscaffold_07:89772..91293
Strand+
Gene length (bp)1521
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 5.0E-22 26 130

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.2193 0.1328 0.5609 0.1804 0.1596 0.0146 0.5849 0.2019 0.361 0.0035

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999616

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1800
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4581
Ophiocordyceps australis map64 (Brazil) OphauB2|7809
Ophiocordyceps camponoti-floridani Ophcf2|05905 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2164
Ophiocordyceps kimflemingae Ophio5|4846
Ophiocordyceps subramaniannii Hirsu2|1759

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05905
MRTASALVAALLPAVQAMYPKNSPVLRVDASSYKRLIAQSNYTSLVEFYAPWCGHCQNLKPAFEKAASELLGLAK
VAAMDCDAEENKAFCSSMGIQGFPTLKTVRPSTKPGGKPIVEDYQGGRTAGAMIQATADKINNHVVRLSDKDLDK
FLARDKPKFILFTNKGTTSALLRSIAIDFLDQVVVGQIRDRETEAVEKYGIEKFPTFVLFPGKDSSGPIKYDGEV
KKNKLVEFLAQVAQPNPDPAPVTESDKKKKKTKKSKSDEKKAASEEKTKDTKEPSEETTTTTTTPEKETAKPAME
ITPITAIKDKDTLEQKCLQTKSYTCVLALVPSEASEQGDKAVASLSQLNSKYLHGKRHLFPFFSVASDVDGTAHL
RQALKLGSGVELIVVNARRGWWRRFEGDDMGVEAVEGWIDAIRMGEGQKRTLPEGVVVEAAKEEEEEEAKAEEKV
EKVDDDAPEEPKIVHEEL*
Coding >Ophcf2|05905
ATGCGTACCGCCTCCGCCCTAGTGGCCGCGCTGCTGCCGGCAGTACAGGCCATGTATCCCAAGAACTCGCCCGTG
CTTCGCGTCGATGCCAGCTCTTATAAGCGACTGATTGCCCAGTCGAATTACACCTCGCTCGTCGAGTTCTACGCC
CCTTGGTGCGGCCACTGCCAGAACCTCAAGCCTGCTTTTGAAAAGGCAGCCTCCGAACTACTAGGCCTCGCCAAG
GTGGCCGCCATGGACTGCGATGCCGAAGAGAACAAGGCCTTTTGCTCTTCCATGGGCATCCAGGGCTTCCCCACG
CTCAAGACGGTCCGTCCCAGCACCAAGCCCGGCGGAAAGCCTATCGTCGAAGACTACCAGGGCGGACGCACCGCC
GGCGCCATGATCCAGGCCACTGCCGACAAGATCAACAACCACGTCGTCCGCCTGTCCGACAAGGACCTCGACAAG
TTCCTCGCCCGCGACAAGCCCAAGTTTATCCTCTTCACCAACAAGGGCACCACCAGCGCCCTGCTCAGGAGCATC
GCCATCGACTTTCTCGACCAGGTCGTTGTCGGCCAGATCCGCGACAGGGAGACGGAGGCGGTGGAAAAGTACGGC
ATCGAAAAGTTTCCCACCTTTGTCCTCTTCCCGGGCAAGGACTCTTCAGGTCCCATCAAGTATGACGGAGAGGTC
AAGAAGAACAAGCTAGTCGAGTTCTTGGCTCAAGTTGCGCAGCCCAATCCTGACCCTGCGCCCGTCACGGAGAGC
GATAAGAAGAAGAAGAAGACGAAGAAGAGTAAGAGCGACGAGAAGAAGGCGGCAAGCGAGGAAAAGACCAAAGAC
ACCAAGGAGCCGTCGGAAGAGACGACGACAACGACAACGACACCAGAAAAGGAAACGGCTAAGCCGGCCATGGAG
ATTACCCCCATCACCGCCATCAAGGACAAGGACACGCTGGAGCAAAAGTGTCTCCAAACCAAGTCGTACACGTGC
GTCCTCGCTCTCGTCCCCTCAGAGGCGTCAGAGCAGGGCGACAAAGCAGTGGCGTCGCTATCCCAGCTCAACAGC
AAATACCTCCACGGAAAACGACACCTCTTCCCCTTCTTCTCCGTCGCCAGCGACGTCGACGGCACGGCCCATCTG
CGCCAAGCGCTCAAGCTAGGCTCGGGCGTCGAGCTCATCGTCGTCAACGCCCGACGGGGCTGGTGGCGGCGCTTC
GAGGGCGATGACATGGGCGTCGAGGCTGTGGAGGGCTGGATCGATGCCATTCGCATGGGAGAGGGGCAGAAGAGG
ACGTTGCCTGAGGGGGTGGTCGTCGAGGCGGCGAAGGAGGAGGAGGAGGAGGAAGCCAAGGCTGAGGAGAAGGTT
GAAAAGGTGGATGATGATGCCCCCGAGGAGCCCAAGATTGTGCACGAGGAGCTCTAA
Transcript >Ophcf2|05905
ATGCGTACCGCCTCCGCCCTAGTGGCCGCGCTGCTGCCGGCAGTACAGGCCATGTATCCCAAGAACTCGCCCGTG
CTTCGCGTCGATGCCAGCTCTTATAAGCGACTGATTGCCCAGTCGAATTACACCTCGCTCGTCGAGTTCTACGCC
CCTTGGTGCGGCCACTGCCAGAACCTCAAGCCTGCTTTTGAAAAGGCAGCCTCCGAACTACTAGGCCTCGCCAAG
GTGGCCGCCATGGACTGCGATGCCGAAGAGAACAAGGCCTTTTGCTCTTCCATGGGCATCCAGGGCTTCCCCACG
CTCAAGACGGTCCGTCCCAGCACCAAGCCCGGCGGAAAGCCTATCGTCGAAGACTACCAGGGCGGACGCACCGCC
GGCGCCATGATCCAGGCCACTGCCGACAAGATCAACAACCACGTCGTCCGCCTGTCCGACAAGGACCTCGACAAG
TTCCTCGCCCGCGACAAGCCCAAGTTTATCCTCTTCACCAACAAGGGCACCACCAGCGCCCTGCTCAGGAGCATC
GCCATCGACTTTCTCGACCAGGTCGTTGTCGGCCAGATCCGCGACAGGGAGACGGAGGCGGTGGAAAAGTACGGC
ATCGAAAAGTTTCCCACCTTTGTCCTCTTCCCGGGCAAGGACTCTTCAGGTCCCATCAAGTATGACGGAGAGGTC
AAGAAGAACAAGCTAGTCGAGTTCTTGGCTCAAGTTGCGCAGCCCAATCCTGACCCTGCGCCCGTCACGGAGAGC
GATAAGAAGAAGAAGAAGACGAAGAAGAGTAAGAGCGACGAGAAGAAGGCGGCAAGCGAGGAAAAGACCAAAGAC
ACCAAGGAGCCGTCGGAAGAGACGACGACAACGACAACGACACCAGAAAAGGAAACGGCTAAGCCGGCCATGGAG
ATTACCCCCATCACCGCCATCAAGGACAAGGACACGCTGGAGCAAAAGTGTCTCCAAACCAAGTCGTACACGTGC
GTCCTCGCTCTCGTCCCCTCAGAGGCGTCAGAGCAGGGCGACAAAGCAGTGGCGTCGCTATCCCAGCTCAACAGC
AAATACCTCCACGGAAAACGACACCTCTTCCCCTTCTTCTCCGTCGCCAGCGACGTCGACGGCACGGCCCATCTG
CGCCAAGCGCTCAAGCTAGGCTCGGGCGTCGAGCTCATCGTCGTCAACGCCCGACGGGGCTGGTGGCGGCGCTTC
GAGGGCGATGACATGGGCGTCGAGGCTGTGGAGGGCTGGATCGATGCCATTCGCATGGGAGAGGGGCAGAAGAGG
ACGTTGCCTGAGGGGGTGGTCGTCGAGGCGGCGAAGGAGGAGGAGGAGGAGGAAGCCAAGGCTGAGGAGAAGGTT
GAAAAGGTGGATGATGATGCCCCCGAGGAGCCCAAGATTGTGCACGAGGAGCTCTAA
Gene >Ophcf2|05905
ATGCGTACCGCCTCCGCCCTAGTGGCCGCGCTGCTGCCGGCAGTACAGGCCATGTATCCCAAGAACTCGCCCGTG
CTTCGCGTCGATGCCAGCTCTTATAAGCGACTGATTGCCCAGTCGAATTACACCTCGGTATGGTCTCGATACCGT
CTCTATCGAGCTCGACATGCGCGCTGACACCGACATGGCGGTCCAGCTCGTCGAGTTCTACGCCCCTTGGTGCGG
CCACTGCCAGAACCTCAAGCCTGCTTTTGAAAAGGCAGCCTCCGAACTACTAGGCCTCGCCAAGGTGGCCGCCAT
GGACTGCGATGCCGAAGAGAACAAGGCCTTTTGCTCTTCCATGGGCATCCAGGGCTTCCCCACGCTCAAGACGGT
CCGTCCCAGCACCAAGCCCGGCGGAAAGCCTATCGTCGAAGACTACCAGGGCGGACGCACCGCCGGCGCCATGAT
CCAGGCCACTGCCGACAAGATCAACAACCACGTCGTCCGCCTGTCCGACAAGGACCTCGACAAGTTCCTCGCCCG
CGACAAGCCCAAGTTTATCCTCTTCACCAACAAGGGCACCACCAGCGCCCTGCTCAGGAGCATCGCCATCGACTT
TCTCGACCAGGTCGTTGTCGGCCAGATCCGCGACAGGGAGACGGAGGCGGTGGAAAAGTACGGCATCGAAAAGTT
TCCCACCTTTGTCCTCTTCCCGGGCAAGGACTCTTCAGGTCCCATCAAGTATGACGGAGAGGTCAAGAAGAACAA
GCTAGTCGAGTTCTTGGCTCAAGTTGCGCAGCCCAATCCTGACCCTGCGCCCGTCACGGAGAGCGATAAGAAGAA
GAAGAAGACGAAGAAGAGTAAGAGCGACGAGAAGAAGGCGGCAAGCGAGGAAAAGACCAAAGACACCAAGGAGCC
GTCGGAAGAGACGACGACAACGACAACGACACCAGAAAAGGAAACGGCTAAGCCGGCCATGGAGATTACCCCCAT
CACCGCCATCAAGGACAAGGACACGCTGGAGCAAAAGTGTCTCCAAACCAAGTCGTACACGTGCGTCCTCGCTCT
CGTCCCCTCAGAGGCGTCAGAGCAGGGCGACAAAGCAGTGGCGTCGCTATCCCAGCTCAACAGCAAATACCTCCA
CGGAAAACGACACCTCTTCCCCTTCTTCTCCGTCGCCAGCGACGTCGACGGCACGGCCCATCTGCGCCAAGCGCT
CAAGCTAGGCTCGGGCGTCGAGCTCATCGTCGTCAACGCCCGACGGGGCTGGTGGCGGCGCTTCGAGGGCGATGA
CATGGGCGTCGAGGCTGTGGAGGGCTGGATCGATGCCATTCGCATGGGAGAGGGGCAGAAGAGGACGTTGCCTGA
GGGGGTGGTCGTCGAGGCGGCGAAGGAGGAGGAGGAGGAGGAAGCCAAGGTGGAAAAGGGGGGTAAGGGGGCGGA
AAAGGGGACAAGGAGGAGGCCAAGGCTGAGGAGAAGGTTGAAAAGGTGGATGATGATGCCCCCGAGGAGCCCAAG
ATTGTGCACGAGGAGCTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail