Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05904
Gene name
Locationscaffold_07:88268..89473
Strand-
Gene length (bp)1205
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04652 Vta1 Vta1 like 2.2E-46 13 156
PF18097 Vta1_C Vta1 C-terminal domain 6.1E-16 311 344

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6629 0.6094 0.0637 0.101 0.1403 0.0027 0.0586 0.2584 0.1674 0.0106

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1801
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4580
Ophiocordyceps australis map64 (Brazil) OphauB2|7810
Ophiocordyceps camponoti-floridani Ophcf2|05904 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2165
Ophiocordyceps kimflemingae Ophio5|4847
Ophiocordyceps subramaniannii Hirsu2|1760

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05904
MEPLPPGLKIPEVSRFINRANQLRSIKPALAYWCEYHAVNQIVGRSLHTTDDASFAFTKTLIERLEATKAERADD
DAIVDNEAGQAYVESFANETFARAERALRADKVTRQTADTFDAAATFFDLTREWGAPDAETVQKIKFAKWNAARI
LKAIREGRDPNESNPSKPEPVQANQPQLDPDDPSVRQIISPPPPVTVQDVPDDDAVVEAPPAESDYFPPVPSDTM
ASGVNPTGFAPSDPMPGISPTAVQPDHPHLPASAPSFQPPSSRVSVSDASSPTAWAPAHPAASTIFAPSPAVGVL
GVPSASTTSQRDINEAQRHAKWAISALNFDDVPTAVKELRNALHKLGATL*
Coding >Ophcf2|05904
ATGGAGCCGCTACCCCCCGGCCTCAAGATCCCCGAGGTCAGCCGGTTCATCAACCGAGCGAACCAGCTGCGGAGC
ATCAAGCCCGCCCTCGCCTACTGGTGCGAGTACCATGCCGTCAACCAGATTGTAGGCCGTAGCCTGCACACGACC
GACGACGCGAGCTTCGCCTTCACCAAGACGCTTATCGAGAGGCTTGAGGCTACAAAGGCTGAGAGGGCCGATGAC
GACGCCATTGTCGATAATGAGGCGGGGCAGGCTTATGTCGAGTCGTTTGCCAATGAGACGTTTGCCAGGGCTGAG
AGGGCCTTGCGGGCGGATAAGGTGACGAGGCAAACGGCTGATACCTTTGACGCCGCCGCCACCTTCTTCGACCTC
ACTCGCGAATGGGGAGCCCCCGACGCAGAAACGGTGCAAAAGATCAAGTTTGCCAAATGGAACGCCGCCCGCATC
CTCAAGGCTATCCGCGAGGGCAGGGATCCCAACGAGTCCAACCCTTCGAAGCCGGAGCCCGTCCAGGCCAACCAG
CCGCAGCTAGACCCGGACGACCCGTCCGTTCGGCAGATTATCAGTCCGCCGCCGCCCGTCACGGTCCAAGACGTG
CCTGACGACGACGCCGTCGTCGAAGCTCCGCCGGCCGAGTCCGATTACTTTCCTCCCGTGCCGTCTGATACTATG
GCGTCGGGTGTGAATCCGACTGGCTTTGCTCCGTCCGATCCGATGCCTGGCATCTCTCCCACGGCTGTGCAGCCC
GACCACCCGCATCTACCGGCTTCAGCACCCAGCTTCCAACCGCCCTCTTCCCGGGTGTCCGTCTCCGACGCTTCG
TCACCTACAGCCTGGGCCCCCGCCCACCCTGCTGCTTCCACCATCTTTGCGCCTTCTCCCGCCGTGGGTGTTTTG
GGTGTGCCTTCAGCCTCTACGACGAGCCAACGCGACATCAACGAGGCGCAGAGGCACGCGAAGTGGGCCATTTCA
GCACTCAATTTCGACGACGTCCCTACGGCGGTCAAGGAGCTGCGGAATGCTCTTCACAAGTTGGGGGCGACGTTA
TGA
Transcript >Ophcf2|05904
ATGGAGCCGCTACCCCCCGGCCTCAAGATCCCCGAGGTCAGCCGGTTCATCAACCGAGCGAACCAGCTGCGGAGC
ATCAAGCCCGCCCTCGCCTACTGGTGCGAGTACCATGCCGTCAACCAGATTGTAGGCCGTAGCCTGCACACGACC
GACGACGCGAGCTTCGCCTTCACCAAGACGCTTATCGAGAGGCTTGAGGCTACAAAGGCTGAGAGGGCCGATGAC
GACGCCATTGTCGATAATGAGGCGGGGCAGGCTTATGTCGAGTCGTTTGCCAATGAGACGTTTGCCAGGGCTGAG
AGGGCCTTGCGGGCGGATAAGGTGACGAGGCAAACGGCTGATACCTTTGACGCCGCCGCCACCTTCTTCGACCTC
ACTCGCGAATGGGGAGCCCCCGACGCAGAAACGGTGCAAAAGATCAAGTTTGCCAAATGGAACGCCGCCCGCATC
CTCAAGGCTATCCGCGAGGGCAGGGATCCCAACGAGTCCAACCCTTCGAAGCCGGAGCCCGTCCAGGCCAACCAG
CCGCAGCTAGACCCGGACGACCCGTCCGTTCGGCAGATTATCAGTCCGCCGCCGCCCGTCACGGTCCAAGACGTG
CCTGACGACGACGCCGTCGTCGAAGCTCCGCCGGCCGAGTCCGATTACTTTCCTCCCGTGCCGTCTGATACTATG
GCGTCGGGTGTGAATCCGACTGGCTTTGCTCCGTCCGATCCGATGCCTGGCATCTCTCCCACGGCTGTGCAGCCC
GACCACCCGCATCTACCGGCTTCAGCACCCAGCTTCCAACCGCCCTCTTCCCGGGTGTCCGTCTCCGACGCTTCG
TCACCTACAGCCTGGGCCCCCGCCCACCCTGCTGCTTCCACCATCTTTGCGCCTTCTCCCGCCGTGGGTGTTTTG
GGTGTGCCTTCAGCCTCTACGACGAGCCAACGCGACATCAACGAGGCGCAGAGGCACGCGAAGTGGGCCATTTCA
GCACTCAATTTCGACGACGTCCCTACGGCGGTCAAGGAGCTGCGGAATGCTCTTCACAAGTTGGGGGCGACGTTA
TGA
Gene >Ophcf2|05904
ATGGAGCCGCTACCCCCCGGCCTCAAGATCCCCGAGGTCAGCCGGTTCATCAACCGAGCGAACCAGCTGCGGAGC
ATCAAGCCCGCCCTCGCCTACTGGTGTGCGTGAGCGCGCCCTCTTCCTTGTCCCTTCGCGCCCGTCCCCTCACGC
GAACGGAAAATTCTGCGTCCTCTCTTCCAGGCGAGTACCATGCCGTCAACCAGATTGTAGGCCGTAGCCTGCACA
CGACCGACGACGCGAGCTTCGCCTTCACCAAGACGCTTATCGAGAGGCTTGAGGCTACAAAGGCTGAGAGGGCCG
ATGACGACGCCATTGTCGATAATGAGGCGGGGCAGGCTTATGTCGAGTCGTTTGCCAATGAGACGTTTGCCAGGG
CTGAGAGGGCCTTGCGGGCGGATAAGGTGACGAGGTGGGCTTGCTAACTTTTTTCTCTTGTTCTGCATGCCTGGG
TTCTTCTGTTGATCGCTTCACTGTGGTACAGGCAAACGGCTGATACCTTTGACGCCGCCGCCACCTTCTTCGACC
TCACTCGCGAATGGGGAGCCCCCGACGCAGAAACGGTGCAAAAGATCAAGTTTGCCAAATGGAACGCCGCCCGCA
TCCTCAAGGCTATCCGCGAGGGCAGGGATCCCAACGAGTCCAACCCTTCGAAGCCGGAGCCCGTCCAGGCCAACC
AGCCGCAGCTAGACCCGGACGACCCGTCCGTTCGGCAGATTATCAGTCCGCCGCCGCCCGTCACGGTCCAAGACG
TGCCTGACGACGACGCCGTCGTCGAAGCTCCGCCGGCCGAGTCCGATTACTTTCCTCCCGTGCCGTCTGATACTA
TGGCGTCGGGTGTGAATCCGACTGGCTTTGCTCCGTCCGATCCGATGCCTGGCATCTCTCCCACGGCTGTGCAGC
CCGACCACCCGCATCTACCGGCTTCAGCACCCAGCTTCCAACCGCCCTCTTCCCGGGTGTCCGTCTCCGACGCTT
CGTCACCTACAGCCTGGGCCCCCGCCCACCCTGCTGCTTCCACCATCTTTGCGCCTTCTCCCGCCGTGGGTGTTT
TGGGTGTGCCTTCAGCCTCTACGACGAGCCAACGCGACATCAACGAGGCGCAGAGGCACGCGAAGTGGGCCATTT
CAGCACTCAATTTCGACGACGTCCCTACGGCGGTCAAGGAGCTGCGGAATGCTCTTCACAAGTTGGGGGCGACGT
TATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail