Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05901
Gene name
Locationscaffold_07:83045..84050
Strand+
Gene length (bp)1005
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 2.4E-10 102 154

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 12 31 19
2 281 303 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05901
MASLMRWSSRKVGALVFLALLFLLVVHQVSYISDIDFANRLPDPLQVVSQCSAESQHDNTGIPKRIHQMWKTNNV
SSYPIEATHTAWKSMFEPADYTVKLWAEADIVNLIAAKYPWLLSTYQGYSQNIQRADVARLVVLHAEGGIYADLD
VHPVSLQEISCWRHLGLQALFAPTSGTQGISNHFVMAEKGSAFLQWALHEAKRRGGASSRRIIFPYLQVFWSTGP
LMVNSAYRSYVSHMGQADKPVGVAEERYGGSVIRHAAGRSWHKSDGLFLNYVADRVGVGSSYIVIVAPMLFLALA
AFLARRHFKAGMLASRDGPLSPIIERIQAFKDRS*
Coding >Ophcf2|05901
ATGGCCTCCCTAATGAGATGGAGTTCCCGAAAAGTCGGTGCCCTCGTCTTCCTCGCTCTCCTCTTCCTCCTCGTC
GTCCACCAGGTCAGCTACATAAGCGACATCGACTTCGCCAACCGCCTCCCCGACCCCCTACAAGTCGTCAGCCAA
TGCTCAGCCGAGAGCCAACATGACAACACCGGGATCCCCAAGCGTATTCATCAGATGTGGAAGACCAACAACGTC
TCATCATACCCCATCGAAGCTACCCACACTGCCTGGAAGTCAATGTTCGAACCGGCAGACTACACCGTCAAACTC
TGGGCCGAGGCCGACATCGTCAACCTGATAGCGGCAAAGTACCCCTGGCTCCTGTCGACATATCAGGGCTACTCG
CAGAACATCCAACGCGCAGACGTCGCCAGGCTCGTCGTCCTTCACGCCGAGGGCGGCATCTACGCTGATCTCGAC
GTCCACCCCGTCTCGCTACAAGAAATCTCCTGCTGGCGTCATCTCGGGCTTCAGGCCCTCTTCGCCCCAACTTCG
GGAACGCAGGGCATCAGCAACCACTTCGTCATGGCCGAAAAGGGCTCCGCCTTTCTCCAATGGGCCCTACACGAG
GCCAAGCGTCGAGGAGGAGCCTCGTCTCGACGAATCATCTTCCCCTACCTTCAGGTCTTTTGGTCGACGGGGCCT
CTCATGGTCAACTCGGCTTACCGCTCCTACGTCTCGCATATGGGTCAGGCAGATAAGCCGGTGGGCGTGGCCGAG
GAGAGATACGGCGGATCCGTCATCCGGCACGCTGCAGGCCGGTCATGGCACAAGTCTGACGGCCTGTTCCTGAAT
TACGTCGCCGACAGGGTTGGAGTGGGCAGTTCCTACATCGTCATTGTCGCCCCTATGCTTTTCCTCGCTCTGGCG
GCTTTCCTGGCGAGACGACACTTCAAGGCCGGCATGTTGGCTTCTCGTGATGGGCCGCTGTCTCCCATCATCGAA
CGGATACAAGCATTCAAAGATAGATCATGA
Transcript >Ophcf2|05901
ATGGCCTCCCTAATGAGATGGAGTTCCCGAAAAGTCGGTGCCCTCGTCTTCCTCGCTCTCCTCTTCCTCCTCGTC
GTCCACCAGGTCAGCTACATAAGCGACATCGACTTCGCCAACCGCCTCCCCGACCCCCTACAAGTCGTCAGCCAA
TGCTCAGCCGAGAGCCAACATGACAACACCGGGATCCCCAAGCGTATTCATCAGATGTGGAAGACCAACAACGTC
TCATCATACCCCATCGAAGCTACCCACACTGCCTGGAAGTCAATGTTCGAACCGGCAGACTACACCGTCAAACTC
TGGGCCGAGGCCGACATCGTCAACCTGATAGCGGCAAAGTACCCCTGGCTCCTGTCGACATATCAGGGCTACTCG
CAGAACATCCAACGCGCAGACGTCGCCAGGCTCGTCGTCCTTCACGCCGAGGGCGGCATCTACGCTGATCTCGAC
GTCCACCCCGTCTCGCTACAAGAAATCTCCTGCTGGCGTCATCTCGGGCTTCAGGCCCTCTTCGCCCCAACTTCG
GGAACGCAGGGCATCAGCAACCACTTCGTCATGGCCGAAAAGGGCTCCGCCTTTCTCCAATGGGCCCTACACGAG
GCCAAGCGTCGAGGAGGAGCCTCGTCTCGACGAATCATCTTCCCCTACCTTCAGGTCTTTTGGTCGACGGGGCCT
CTCATGGTCAACTCGGCTTACCGCTCCTACGTCTCGCATATGGGTCAGGCAGATAAGCCGGTGGGCGTGGCCGAG
GAGAGATACGGCGGATCCGTCATCCGGCACGCTGCAGGCCGGTCATGGCACAAGTCTGACGGCCTGTTCCTGAAT
TACGTCGCCGACAGGGTTGGAGTGGGCAGTTCCTACATCGTCATTGTCGCCCCTATGCTTTTCCTCGCTCTGGCG
GCTTTCCTGGCGAGACGACACTTCAAGGCCGGCATGTTGGCTTCTCGTGATGGGCCGCTGTCTCCCATCATCGAA
CGGATACAAGCATTCAAAGATAGATCATGA
Gene >Ophcf2|05901
ATGGCCTCCCTAATGAGATGGAGTTCCCGAAAAGTCGGTGCCCTCGTCTTCCTCGCTCTCCTCTTCCTCCTCGTC
GTCCACCAGGTCAGCTACATAAGCGACATCGACTTCGCCAACCGCCTCCCCGACCCCCTACAAGTCGTCAGCCAA
TGCTCAGCCGAGAGCCAACATGACAACACCGGGATCCCCAAGCGTATTCATCAGATGTGGAAGACCAACAACGTC
TCATCATACCCCATCGAAGCTACCCACACTGCCTGGAAGTCAATGTTCGAACCGGCAGACTACACCGTCAAACTC
TGGGCCGAGGCCGACATCGTCAACCTGATAGCGGCAAAGTACCCCTGGCTCCTGTCGACATATCAGGGCTACTCG
CAGAACATCCAACGCGCAGACGTCGCCAGGCTCGTCGTCCTTCACGCCGAGGGCGGCATCTACGCTGATCTCGAC
GTCCACCCCGTCTCGCTACAAGAAATCTCCTGCTGGCGTCATCTCGGGCTTCAGGCCCTCTTCGCCCCAACTTCG
GGAACGCAGGGCATCAGCAACCACTTCGTCATGGCCGAAAAGGGCTCCGCCTTTCTCCAATGGGCCCTACACGAG
GCCAAGCGTCGAGGAGGAGCCTCGTCTCGACGAATCATCTTCCCCTACCTTCAGGTCTTTTGGTCGACGGGGCCT
CTCATGGTCAACTCGGCTTACCGCTCCTACGTCTCGCATATGGGTCAGGCAGATAAGCCGGTGGGCGTGGCCGAG
GAGAGATACGGCGGATCCGTCATCCGGCACGCTGCAGGCCGGTCATGGCACAAGTCTGACGGCCTGTTCCTGAAT
TACGTCGCCGACAGGGTTGGAGTGGGCAGTTCCTACATCGTCATTGTCGCCCCTATGCTTTTCCTCGCTCTGGCG
GCTTTCCTGGCGAGACGACACTTCAAGGCCGGCATGTTGGCTTCTCGTGATGGGCCGCTGTCTCCCATCATCGAA
CGGATACAAGCATTCAAAGATAGATCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail