Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05896
Gene name
Locationscaffold_07:70012..70630
Strand-
Gene length (bp)618
Transcript length (bp)561
Coding sequence length (bp)561
Protein length (aa) 187

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 20 39 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 112.19 60.36 164.01
Alive In ants, during behavior modification 60.72 28.52 92.91
Dead In ants, recently dead 55.70 25.80 85.61

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.003275 yes
Alive Dead 0.721465 no
Dead Fungus 0.000454 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05896
MEPSWERQGRLAIPTTNRLLFGSLASGSVGFGLGAVQGARMAQLRFRAEHAHKMPDSTTGWYLYHKTKNYHAMFG
GVREGLSMGVKTSFWTTLALGLENTVDGCRGASDMFSTIVATLTVAGAFSLYHKLTLSAATRTARMGLMFGLVYG
GVQDVVGLARGRPIGYVDLIRRRLGFASRDADDQHR*
Coding >Ophcf2|05896
ATGGAGCCTTCGTGGGAGCGTCAAGGGCGGCTCGCGATACCGACGACGAACCGGCTGCTGTTCGGCTCCCTTGCA
TCCGGCTCCGTCGGCTTCGGTCTCGGCGCCGTGCAGGGCGCTCGCATGGCGCAGTTGCGCTTCCGGGCCGAGCAT
GCCCACAAGATGCCCGATTCCACGACGGGCTGGTACCTCTACCACAAGACCAAGAACTACCACGCCATGTTCGGC
GGCGTCCGCGAGGGCCTTTCCATGGGCGTCAAGACGAGCTTCTGGACCACGTTGGCCCTCGGCCTCGAGAATACT
GTCGATGGGTGTCGCGGTGCCAGCGACATGTTCTCGACTATAGTTGCTACCCTTACCGTTGCCGGCGCCTTTTCC
CTTTACCATAAGTTGACGCTGTCAGCGGCCACCCGTACCGCTAGAATGGGTCTCATGTTCGGGCTCGTGTACGGC
GGTGTTCAGGATGTCGTCGGCTTAGCCCGCGGCAGGCCCATCGGCTACGTCGACCTCATCCGACGCCGGCTCGGC
TTTGCGTCACGGGATGCAGACGACCAGCATCGGTGA
Transcript >Ophcf2|05896
ATGGAGCCTTCGTGGGAGCGTCAAGGGCGGCTCGCGATACCGACGACGAACCGGCTGCTGTTCGGCTCCCTTGCA
TCCGGCTCCGTCGGCTTCGGTCTCGGCGCCGTGCAGGGCGCTCGCATGGCGCAGTTGCGCTTCCGGGCCGAGCAT
GCCCACAAGATGCCCGATTCCACGACGGGCTGGTACCTCTACCACAAGACCAAGAACTACCACGCCATGTTCGGC
GGCGTCCGCGAGGGCCTTTCCATGGGCGTCAAGACGAGCTTCTGGACCACGTTGGCCCTCGGCCTCGAGAATACT
GTCGATGGGTGTCGCGGTGCCAGCGACATGTTCTCGACTATAGTTGCTACCCTTACCGTTGCCGGCGCCTTTTCC
CTTTACCATAAGTTGACGCTGTCAGCGGCCACCCGTACCGCTAGAATGGGTCTCATGTTCGGGCTCGTGTACGGC
GGTGTTCAGGATGTCGTCGGCTTAGCCCGCGGCAGGCCCATCGGCTACGTCGACCTCATCCGACGCCGGCTCGGC
TTTGCGTCACGGGATGCAGACGACCAGCATCGGTGA
Gene >Ophcf2|05896
ATGGAGCCTTCGTGGGAGCGTCAAGGGCGGCTCGCGATACCGACGACGAACCGGCTGCTGTTCGGCTCCCTTGCA
TCCGGCTCCGTCGGCTTCGGTCTCGGCGCCGTGCAGGGCGCTCGCATGGCGCAGTTGCGCTTCCGGGCCGAGCAT
GCCCACAAGATGCCCGATTCCACGACGGGCTGGTACCTCTACCACAAGACCAAGAACTACCACGCCATGTTCGGC
GGCGTCCGCGAGGGCCTTTCCATGGGCGTCAAGACGAGCTTCTGGACCACGTTGGCCCTCGGCCTCGAGAATACT
GTCGATGGGTGTCGCGGTGCCAGCGACATGTTCTCGACTATAGTTGCTACCCTTACCGTTGCCGGCGCCTTTTCC
CTTTACCGTACGTTGCCGCCTCTTTGATTGCACAATCTCTATCTTCATATTGACAATCAAAAAGATAAGTTGACG
CTGTCAGCGGCCACCCGTACCGCTAGAATGGGTCTCATGTTCGGGCTCGTGTACGGCGGTGTTCAGGATGTCGTC
GGCTTAGCCCGCGGCAGGCCCATCGGCTACGTCGACCTCATCCGACGCCGGCTCGGCTTTGCGTCACGGGATGCA
GACGACCAGCATCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail