Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05880
Gene name
Locationscaffold_06:2498655..2499823
Strand+
Gene length (bp)1168
Transcript length (bp)948
Coding sequence length (bp)948
Protein length (aa) 316

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04321 RmlD_sub_bind RmlD substrate binding domain 2.0E-57 5 294
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.1E-22 6 206
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 7.9E-10 39 156
PF07993 NAD_binding_4 Male sterility protein 1.0E-07 64 191
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 1.5E-05 47 149
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 8.7E-07 7 183

GO

GO Term Description Terminal node
GO:0006694 steroid biosynthetic process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008152 metabolic process No
GO:0016229 steroid dehydrogenase activity No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0016491 oxidoreductase activity No
GO:0008202 steroid metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:0008610 lipid biosynthetic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7115 0.5159 0.0997 0.039 0.3533 0.0836 0.0273 0.093 0.0819 0.0271

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2076
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4147
Ophiocordyceps australis map64 (Brazil) OphauB2|7766
Ophiocordyceps camponoti-floridani Ophcf2|05880 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07451
Ophiocordyceps camponoti-rufipedis Ophun1|7206
Ophiocordyceps kimflemingae Ophio5|452
Ophiocordyceps subramaniannii Hirsu2|2402

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05880
MAQQSVLVTGATGLLGREVVNAFRLGGWKVKGTGHSRADGVDVLRIDLTKEDEVARALDEIKPQVIVHCAAEKAP
DKVAKDPEGARALNVAASASLAMLAADRGILVIYISTDYVFPGTAGDAPYEADATPRPTNLYGQTKLDGERAVLD
AYERVGRPGLGVVLRVPVLYGHAETPGESAVNSLLDLVWKAQTEGLEMTMDHWARRYPTNTEDVGRVCCDVAAKY
VDSQQQLPRVLQFSSEDNMTKYDICQRLGSMMGLSTASIKANTEGNEAHSSAQRPYDCHLSTSTLQGLGIDVSTC
DFDAWWRREVGAFRK*
Coding >Ophcf2|05880
ATGGCCCAACAATCTGTACTTGTCACCGGCGCAACGGGTCTCCTCGGCCGAGAAGTAGTCAACGCCTTTCGCCTC
GGTGGATGGAAGGTCAAGGGTACAGGCCACTCTCGCGCAGATGGTGTCGACGTCCTCCGCATCGACTTGACCAAG
GAAGACGAGGTCGCGAGAGCGCTGGACGAGATCAAACCGCAGGTCATCGTCCACTGCGCAGCCGAAAAGGCGCCT
GACAAGGTGGCCAAGGACCCAGAAGGCGCGCGAGCGCTCAACGTGGCAGCCAGCGCAAGCCTCGCCATGCTAGCG
GCTGACCGGGGCATCCTCGTCATCTACATCTCGACCGACTACGTGTTCCCCGGCACGGCCGGCGATGCGCCCTAC
GAGGCCGATGCCACGCCGCGGCCGACCAACCTGTACGGGCAGACCAAGCTGGACGGCGAGCGGGCTGTGCTGGAC
GCGTACGAGCGGGTGGGCAGACCGGGCCTGGGCGTGGTGCTGCGCGTGCCCGTCCTCTACGGCCACGCGGAGACG
CCGGGCGAGAGCGCCGTCAACAGTCTGCTGGACCTGGTGTGGAAAGCGCAGACGGAGGGGTTGGAGATGACAATG
GACCACTGGGCGCGGCGGTACCCTACAAACACGGAAGACGTGGGACGCGTTTGTTGCGATGTGGCGGCAAAGTAT
GTCGACTCGCAACAGCAGTTGCCAAGGGTGCTGCAGTTTTCGAGCGAGGACAACATGACGAAGTACGACATCTGT
CAGCGCTTGGGCTCCATGATGGGCCTCTCGACGGCAAGCATCAAGGCAAATACGGAGGGAAATGAGGCCCATTCC
TCGGCGCAGCGGCCGTACGATTGCCACCTTAGCACGTCGACCCTCCAGGGTCTGGGGATCGACGTGTCGACGTGC
GACTTTGACGCATGGTGGCGGCGCGAAGTAGGCGCCTTTCGAAAATGA
Transcript >Ophcf2|05880
ATGGCCCAACAATCTGTACTTGTCACCGGCGCAACGGGTCTCCTCGGCCGAGAAGTAGTCAACGCCTTTCGCCTC
GGTGGATGGAAGGTCAAGGGTACAGGCCACTCTCGCGCAGATGGTGTCGACGTCCTCCGCATCGACTTGACCAAG
GAAGACGAGGTCGCGAGAGCGCTGGACGAGATCAAACCGCAGGTCATCGTCCACTGCGCAGCCGAAAAGGCGCCT
GACAAGGTGGCCAAGGACCCAGAAGGCGCGCGAGCGCTCAACGTGGCAGCCAGCGCAAGCCTCGCCATGCTAGCG
GCTGACCGGGGCATCCTCGTCATCTACATCTCGACCGACTACGTGTTCCCCGGCACGGCCGGCGATGCGCCCTAC
GAGGCCGATGCCACGCCGCGGCCGACCAACCTGTACGGGCAGACCAAGCTGGACGGCGAGCGGGCTGTGCTGGAC
GCGTACGAGCGGGTGGGCAGACCGGGCCTGGGCGTGGTGCTGCGCGTGCCCGTCCTCTACGGCCACGCGGAGACG
CCGGGCGAGAGCGCCGTCAACAGTCTGCTGGACCTGGTGTGGAAAGCGCAGACGGAGGGGTTGGAGATGACAATG
GACCACTGGGCGCGGCGGTACCCTACAAACACGGAAGACGTGGGACGCGTTTGTTGCGATGTGGCGGCAAAGTAT
GTCGACTCGCAACAGCAGTTGCCAAGGGTGCTGCAGTTTTCGAGCGAGGACAACATGACGAAGTACGACATCTGT
CAGCGCTTGGGCTCCATGATGGGCCTCTCGACGGCAAGCATCAAGGCAAATACGGAGGGAAATGAGGCCCATTCC
TCGGCGCAGCGGCCGTACGATTGCCACCTTAGCACGTCGACCCTCCAGGGTCTGGGGATCGACGTGTCGACGTGC
GACTTTGACGCATGGTGGCGGCGCGAAGTAGGCGCCTTTCGAAAATGA
Gene >Ophcf2|05880
ATGGCCCAACAATCTGTACTTGTCACCGGCGCAACGGGTCTCCTCGGCCGAGAAGTAGTCAACGCCTTTCGCCTC
GGTGGATGGAAGGTCAAGGGTACAGGCCACTCTCGCGCAGATGGTGTCGACGTCCTCCGCATCGACTTGACCAAG
GAAGACGAGGTCGCGAGAGCGCTGGACGAGATCAAGTTTGCCCTCCCTGAGCGGTGAAGAAGCTATCGATGACGA
CTGACGAAGTTTACCGGGGGGGATCAGACCGCAGGTCATCGTCCACTGTGAGTGACGAGAGTGATTGTCAAGACG
GCAGATGATGACACGCGGAGTCACCTAGGCGCAGCCGAAAAGGCGCCTGACAAGGTGGCCAAGGACCCAGAAGGC
GCGCGAGCGCTCAACGTGGCAGCCAGCGCAAGCCTCGCCATGCTAGCGGCTGACCGGGGCATCCTCGTCATCTAC
ATCTCGACCGACTACGTGTTCCCCGGCACGGCCGGCGATGCGCCCTACGAGGCCGATGCCACGCCGCGGCCGACC
AACCTGTACGGGCAGACCAAGCTGGACGGCGAGCGGGCTGTGCTGGACGCGTACGAGCGGGTGGGCAGACCGGGC
CTGGGCGTGGTGCTGCGCGTGCCCGTCCTCTACGGCCACGCGGAGACGCCGGGCGAGAGCGCCGTCAACAGTCTG
CTGGACCTGGTGTGGAAAGCGCAGACGGAGGGGTTGGAGATGACAATGGACCACTGGGCGCGGCGGTACCCTACA
AACACGGAAGACGTGGGACGCGTTTGTTGCGGTATGTCTCAGGACCCCTCCACCCCTGCCCGTCCCCCTTCCCGC
TGCCCCTCGTCCGAATATATTGTTCGCATATACGAGCCTGAGAACCCCTTCAGATGTGGCGGCAAAGTATGTCGA
CTCGCAACAGCAGTTGCCAAGGGTGCTGCAGTTTTCGAGCGAGGACAACATGACGAAGTACGACATCTGTCAGCG
CTTGGGCTCCATGATGGGCCTCTCGACGGCAAGCATCAAGGCAAATACGGAGGGAAATGAGGCCCATTCCTCGGC
GCAGCGGCCGTACGATTGCCACCTTAGCACGTCGACCCTCCAGGGTCTGGGGATCGACGTGTCGACGTGCGACTT
TGACGCATGGTGGCGGCGCGAAGTAGGCGCCTTTCGAAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail