Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05870
Gene name
Locationscaffold_06:2477705..2478518
Strand+
Gene length (bp)813
Transcript length (bp)636
Coding sequence length (bp)636
Protein length (aa) 212

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01105 EMP24_GP25L emp24/gp25L/p24 family/GOLD 2.8E-48 22 204

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 177 199 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05870
MRLPTIAAGVFACLVTNVVATALTYKLEAGEKACFYAETNKENEKIAFYFAVQSGGSFDIDYRVEGPDSKIILEG
EKERQGDFVFSAQKTGEYSFCFDNEMSTFTEKMIDIEISSEHEARTAQLPSKQGTSPEQTSVLEESIFKISGQLS
TISRNQKYFRTRENRNFSTVNSTEKRIVNFSVIQICLIVCMGALQVLVVRFFFQGARKGYV*
Coding >Ophcf2|05870
ATGAGACTGCCAACCATCGCAGCGGGCGTCTTTGCCTGTTTAGTCACCAATGTCGTCGCCACGGCGCTGACGTAC
AAGCTGGAAGCGGGCGAGAAGGCCTGCTTCTACGCCGAGACCAACAAGGAGAACGAGAAGATTGCGTTTTATTTT
GCCGTCCAATCTGGAGGCTCTTTCGATATCGACTACCGTGTTGAGGGCCCGGACTCGAAGATTATCCTCGAGGGC
GAGAAGGAGCGTCAAGGCGACTTCGTCTTCTCGGCTCAAAAGACGGGCGAATACTCTTTTTGTTTCGACAACGAG
ATGAGCACCTTTACGGAGAAGATGATCGATATCGAGATCTCAAGCGAGCACGAAGCCCGCACAGCCCAGCTTCCA
TCCAAGCAGGGAACATCTCCCGAGCAAACGTCGGTCCTGGAGGAGTCGATATTCAAGATCTCAGGTCAACTATCT
ACCATCTCGCGCAACCAGAAATACTTTCGAACTCGGGAAAACCGCAACTTTAGCACCGTCAACAGCACAGAGAAA
CGGATTGTCAACTTTAGCGTGATTCAGATTTGCCTTATCGTCTGCATGGGCGCCCTTCAGGTGTTGGTCGTCAGG
TTCTTCTTCCAGGGAGCACGCAAAGGCTATGTATGA
Transcript >Ophcf2|05870
ATGAGACTGCCAACCATCGCAGCGGGCGTCTTTGCCTGTTTAGTCACCAATGTCGTCGCCACGGCGCTGACGTAC
AAGCTGGAAGCGGGCGAGAAGGCCTGCTTCTACGCCGAGACCAACAAGGAGAACGAGAAGATTGCGTTTTATTTT
GCCGTCCAATCTGGAGGCTCTTTCGATATCGACTACCGTGTTGAGGGCCCGGACTCGAAGATTATCCTCGAGGGC
GAGAAGGAGCGTCAAGGCGACTTCGTCTTCTCGGCTCAAAAGACGGGCGAATACTCTTTTTGTTTCGACAACGAG
ATGAGCACCTTTACGGAGAAGATGATCGATATCGAGATCTCAAGCGAGCACGAAGCCCGCACAGCCCAGCTTCCA
TCCAAGCAGGGAACATCTCCCGAGCAAACGTCGGTCCTGGAGGAGTCGATATTCAAGATCTCAGGTCAACTATCT
ACCATCTCGCGCAACCAGAAATACTTTCGAACTCGGGAAAACCGCAACTTTAGCACCGTCAACAGCACAGAGAAA
CGGATTGTCAACTTTAGCGTGATTCAGATTTGCCTTATCGTCTGCATGGGCGCCCTTCAGGTGTTGGTCGTCAGG
TTCTTCTTCCAGGGAGCACGCAAAGGCTATGTATGA
Gene >Ophcf2|05870
ATGAGACTGCCAACCATCGCAGCGGGCGTCTTTGCCTGTTTAGTCACCAATGTCGTCGCCACGGCGCTGACGTAC
AAGCTGGAAGCGGGCGAGAAGGCCTGCTTCTACGCCGAGACCAACAAGGAGAACGAGAAGATTGCGTTTTATTTT
GCCGTAGGCTTTCTTCGCTGAGGCATCTGGGTCTTCTGTGCTTATTCTGACCGCATCATAGGTCCAATCTGGAGG
CTCTTTCGATATCGACTACCGTGTTGAGGGCCCGGACTCGAAGATTATCCTCGAGGGCGAGAAGGAGCGTCAAGG
CGACTTCGTCTTCTCGGCTCAAAAGACGGGCGAATACTCTTTTTGTTTCGACAACGAGATGAGCACCTTTACGGA
GAAGATGATCGATATCGAGATCTCAGTCTGTTCACCCAGCGGCCCTACCGTCATACACAGGCATGCTGATTCTTT
CATGGTGCAGAGCGAGCACGAAGCCCGCACAGCCCAGCTTCCATCCAAGCAGGGAACATCTCCCGAGCAAACGTC
GGTCCTGGAGGAGTCGATATTCAAGATCTCAGGTCAACTATCTACCATCTCGCGCAACCAGAAATACTTTCGAAC
TCGGGAAAACCGCAACTTTAGCACCGTCAACAGCACAGAGAAACGGATTGTCAACTTTAGCGTGATTCAGATTTG
CCTTATCGTCTGCATGGGCGCCCTTCAGGTGTTGGTCGTCAGGTTCTTCTTCCAGGTATGTCCATAAGCCTATGA
TGATCGAGAGTAGTATCTGACAGCCTTTGCCAAACTCAGGGAGCACGCAAAGGCTATGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail