Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05864
Gene name
Locationscaffold_06:2466254..2467710
Strand+
Gene length (bp)1456
Transcript length (bp)1221
Coding sequence length (bp)1221
Protein length (aa) 407

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 1.6E-25 49 337

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 77 99 22
3 114 131 17
4 136 158 22
5 173 190 17
6 197 216 19
7 231 253 22
8 266 288 22
9 292 314 22
10 321 340 19
11 366 388 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 127.19 72.66 181.73
Alive In ants, during behavior modification 164.60 88.97 240.23
Dead In ants, recently dead 195.11 106.66 283.56

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.203489 no
Alive Dead 0.360820 no
Dead Fungus 0.026470 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05864
MAPTSSSSSSADASPVVSQSSTEVFDMGYDEQAIDKGPEPSPSKGLHPALYIANWIFFSNLTILFNKWILDSAGF
RYPILLTCWHLVFSVFATQILARTTTLLDSRHKLPMTPRLYLRTICPIGLFYSGSLVCSNLVYLYLSVAFIQMLK
SAAPVAVLFASWAWRVADPSLDALVNVLVIVAGVALASFGEIQFSLIGFLYQLGGIVFEAVRIVMIQVMLSGQGL
NMDPIVGLYYYAPVCAGMNILVALFTEIPRFKWEDAASVGFFMLLLNALIAFMLNIASVFLIGKTSGLVMTLSGI
LKNILLIVVSVIIWRTEITPLQGVGYTIALAGLTYYSVGYDQLAKCSQGAVAWMAASMPPSTSTLQARRLVLTAI
FALTGLLVLLVGLQRFDGRTGYSPRVDVGTE*
Coding >Ophcf2|05864
ATGGCTCCGACGTCGTCTTCTTCGTCGTCAGCCGACGCCTCGCCCGTTGTCTCCCAATCATCAACCGAAGTCTTC
GACATGGGCTATGACGAGCAAGCAATTGATAAAGGGCCCGAGCCGTCGCCTTCCAAGGGCCTGCATCCCGCGCTA
TACATTGCGAATTGGATATTCTTCTCCAACCTCACCATATTGTTTAACAAATGGATTCTCGACTCTGCTGGCTTC
AGATACCCCATCCTCCTGACGTGCTGGCATCTCGTCTTCTCCGTCTTCGCTACCCAGATCCTCGCTCGTACGACG
ACACTGCTCGACTCGCGCCATAAGCTGCCCATGACGCCCCGTCTCTACCTCCGCACTATCTGCCCCATCGGCCTC
TTCTACTCGGGGTCTCTCGTCTGCTCCAACCTCGTGTATCTCTATCTCTCCGTCGCCTTTATCCAGATGCTCAAA
TCGGCCGCCCCAGTAGCCGTTCTCTTCGCTTCGTGGGCCTGGCGCGTCGCCGATCCGAGCCTGGACGCTCTGGTC
AACGTCCTCGTCATCGTCGCCGGCGTCGCCCTCGCCTCCTTTGGCGAGATACAATTTTCGCTCATCGGCTTCCTC
TACCAGCTAGGTGGCATCGTCTTCGAGGCTGTTCGCATTGTCATGATTCAGGTCATGCTCAGCGGCCAGGGCCTC
AACATGGACCCCATCGTCGGACTCTACTACTATGCCCCCGTCTGCGCCGGCATGAACATACTCGTCGCGCTCTTC
ACCGAGATTCCGCGCTTTAAATGGGAGGACGCGGCTAGCGTTGGCTTCTTCATGCTCCTCCTCAACGCCCTCATC
GCCTTTATGCTCAACATCGCTAGTGTATTCCTGATCGGCAAGACGTCAGGCCTCGTCATGACGCTTAGTGGCATC
CTAAAGAATATTCTACTCATCGTTGTCTCAGTCATCATCTGGCGCACCGAGATCACTCCCCTCCAAGGCGTCGGC
TACACCATCGCCCTAGCCGGCCTCACCTACTACTCCGTAGGCTACGACCAGCTAGCCAAGTGCTCGCAAGGAGCC
GTCGCCTGGATGGCAGCCTCGATGCCGCCCTCTACCTCGACGCTACAGGCCCGCAGGCTCGTCCTCACCGCCATC
TTCGCCCTCACGGGTCTGTTGGTCCTGCTCGTCGGCCTGCAGCGCTTCGACGGGAGGACTGGGTATTCGCCCAGG
GTCGATGTTGGCACCGAGTGA
Transcript >Ophcf2|05864
ATGGCTCCGACGTCGTCTTCTTCGTCGTCAGCCGACGCCTCGCCCGTTGTCTCCCAATCATCAACCGAAGTCTTC
GACATGGGCTATGACGAGCAAGCAATTGATAAAGGGCCCGAGCCGTCGCCTTCCAAGGGCCTGCATCCCGCGCTA
TACATTGCGAATTGGATATTCTTCTCCAACCTCACCATATTGTTTAACAAATGGATTCTCGACTCTGCTGGCTTC
AGATACCCCATCCTCCTGACGTGCTGGCATCTCGTCTTCTCCGTCTTCGCTACCCAGATCCTCGCTCGTACGACG
ACACTGCTCGACTCGCGCCATAAGCTGCCCATGACGCCCCGTCTCTACCTCCGCACTATCTGCCCCATCGGCCTC
TTCTACTCGGGGTCTCTCGTCTGCTCCAACCTCGTGTATCTCTATCTCTCCGTCGCCTTTATCCAGATGCTCAAA
TCGGCCGCCCCAGTAGCCGTTCTCTTCGCTTCGTGGGCCTGGCGCGTCGCCGATCCGAGCCTGGACGCTCTGGTC
AACGTCCTCGTCATCGTCGCCGGCGTCGCCCTCGCCTCCTTTGGCGAGATACAATTTTCGCTCATCGGCTTCCTC
TACCAGCTAGGTGGCATCGTCTTCGAGGCTGTTCGCATTGTCATGATTCAGGTCATGCTCAGCGGCCAGGGCCTC
AACATGGACCCCATCGTCGGACTCTACTACTATGCCCCCGTCTGCGCCGGCATGAACATACTCGTCGCGCTCTTC
ACCGAGATTCCGCGCTTTAAATGGGAGGACGCGGCTAGCGTTGGCTTCTTCATGCTCCTCCTCAACGCCCTCATC
GCCTTTATGCTCAACATCGCTAGTGTATTCCTGATCGGCAAGACGTCAGGCCTCGTCATGACGCTTAGTGGCATC
CTAAAGAATATTCTACTCATCGTTGTCTCAGTCATCATCTGGCGCACCGAGATCACTCCCCTCCAAGGCGTCGGC
TACACCATCGCCCTAGCCGGCCTCACCTACTACTCCGTAGGCTACGACCAGCTAGCCAAGTGCTCGCAAGGAGCC
GTCGCCTGGATGGCAGCCTCGATGCCGCCCTCTACCTCGACGCTACAGGCCCGCAGGCTCGTCCTCACCGCCATC
TTCGCCCTCACGGGTCTGTTGGTCCTGCTCGTCGGCCTGCAGCGCTTCGACGGGAGGACTGGGTATTCGCCCAGG
GTCGATGTTGGCACCGAGTGA
Gene >Ophcf2|05864
ATGGCTCCGACGTCGTCTTCTTCGTCGTCAGCCGACGCCTCGCCCGTTGTCTCCCAATCATCAACCGAAGTCTTC
GACATGGGCTATGACGAGCAAGCAATTGATAAAGGGCCCGAGCCGTCGCCTTCCAAGGGCCTGCATCCCGCGCTA
TACATTGCGTACGACGCTTCGTTTCCTCCACGGTGCGCCGACCTCTTCCGCTGACTCTCTGTCACAGGAATTGGA
TATTCTTCTCCAACCTCACCATATTGTTTAACAAATGGATTCTCGACTCTGCTGGCTTCAGTGAGCTCCTCTTCC
TCCTCAGAAACCTCCGCAAGCTAACAGATCTCAACAGGATACCGTACGTCGTCTCCCCGAGCTTGGCCGACGGTG
AGGCTCTCGCTGACATGCATCGCAGCCATCCTCCTGACGTGCTGGCATCTCGTCTTCTCCGTCTTCGCTACCCAG
ATCCTCGCTCGTACGACGACACTGCTCGACTCGCGCCATAAGCTGCCCATGACGCCCCGTCTCTACCTCCGCACT
ATCTGCCCCATCGGCCTCTTCTACTCGGGGTCTCTCGTCTGCTCCAACCTCGTGTATCTCTATCTCTCCGTCGCC
TTTATCCAGATGCTCAAATCGGCCGCCCCAGTAGCCGTTCTCTTCGCTTCGTGGGCCTGGCGCGTCGCCGATCCG
AGCCTGGACGCTCTGGTCAACGTCCTCGTCATCGTCGCCGGCGTCGCCCTCGCCTCCTTTGGCGAGATACAATTT
TCGCTCATCGGCTTCCTCTACCAGCTAGGTGGCATCGTCTTCGAGGCTGTTCGCATTGTCATGATTCAGGTCATG
CTCAGCGGCCAGGGCCTCAACATGGACCCCATCGTCGGACTCTACTACTATGCCCCCGTCTGCGCCGGCATGAAC
ATACTCGTCGCGCTCTTCACCGAGATTCCGCGCTTTAAATGGGAGGACGCGGCTAGCGTTGGCTTCTTCATGCTC
CTCCTCAACGCCCTCATCGCCTTTATGCTCAACATCGCTAGTGTATTCCTGGTATGGCTTCACCCACCCGCGCGA
TCCCCTCCACATCAAGAGAAGCTAACCGTCGGGGTACCCACAGATCGGCAAGACGTCAGGCCTCGTCATGACGCT
TAGTGGCATCCTAAAGAATATTCTACTCATCGTTGTCTCAGTCATCATCTGGCGCACCGAGATCACTCCCCTCCA
AGGCGTCGGCTACACCATCGCCCTAGCCGGCCTCACCTACTACTCCGTAGGCTACGACCAGCTAGCCAAGTGCTC
GCAAGGAGCCGTCGCCTGGATGGCAGCCTCGATGCCGCCCTCTACCTCGACGCTACAGGCCCGCAGGCTCGTCCT
CACCGCCATCTTCGCCCTCACGGGTCTGTTGGTCCTGCTCGTCGGCCTGCAGCGCTTCGACGGGAGGACTGGGTA
TTCGCCCAGGGTCGATGTTGGCACCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail