Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05864
Gene name
Locationscaffold_06:2466254..2467710
Strand+
Gene length (bp)1456
Transcript length (bp)1221
Coding sequence length (bp)1221
Protein length (aa) 407

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 1.6E-25 49 337

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 77 99 22
3 114 131 17
4 136 158 22
5 173 190 17
6 197 216 19
7 231 253 22
8 266 288 22
9 292 314 22
10 321 340 19
11 366 388 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05864
MAPTSSSSSSADASPVVSQSSTEVFDMGYDEQAIDKGPEPSPSKGLHPALYIANWIFFSNLTILFNKWILDSAGF
RYPILLTCWHLVFSVFATQILARTTTLLDSRHKLPMTPRLYLRTICPIGLFYSGSLVCSNLVYLYLSVAFIQMLK
SAAPVAVLFASWAWRVADPSLDALVNVLVIVAGVALASFGEIQFSLIGFLYQLGGIVFEAVRIVMIQVMLSGQGL
NMDPIVGLYYYAPVCAGMNILVALFTEIPRFKWEDAASVGFFMLLLNALIAFMLNIASVFLIGKTSGLVMTLSGI
LKNILLIVVSVIIWRTEITPLQGVGYTIALAGLTYYSVGYDQLAKCSQGAVAWMAASMPPSTSTLQARRLVLTAI
FALTGLLVLLVGLQRFDGRTGYSPRVDVGTE*
Coding >Ophcf2|05864
ATGGCTCCGACGTCGTCTTCTTCGTCGTCAGCCGACGCCTCGCCCGTTGTCTCCCAATCATCAACCGAAGTCTTC
GACATGGGCTATGACGAGCAAGCAATTGATAAAGGGCCCGAGCCGTCGCCTTCCAAGGGCCTGCATCCCGCGCTA
TACATTGCGAATTGGATATTCTTCTCCAACCTCACCATATTGTTTAACAAATGGATTCTCGACTCTGCTGGCTTC
AGATACCCCATCCTCCTGACGTGCTGGCATCTCGTCTTCTCCGTCTTCGCTACCCAGATCCTCGCTCGTACGACG
ACACTGCTCGACTCGCGCCATAAGCTGCCCATGACGCCCCGTCTCTACCTCCGCACTATCTGCCCCATCGGCCTC
TTCTACTCGGGGTCTCTCGTCTGCTCCAACCTCGTGTATCTCTATCTCTCCGTCGCCTTTATCCAGATGCTCAAA
TCGGCCGCCCCAGTAGCCGTTCTCTTCGCTTCGTGGGCCTGGCGCGTCGCCGATCCGAGCCTGGACGCTCTGGTC
AACGTCCTCGTCATCGTCGCCGGCGTCGCCCTCGCCTCCTTTGGCGAGATACAATTTTCGCTCATCGGCTTCCTC
TACCAGCTAGGTGGCATCGTCTTCGAGGCTGTTCGCATTGTCATGATTCAGGTCATGCTCAGCGGCCAGGGCCTC
AACATGGACCCCATCGTCGGACTCTACTACTATGCCCCCGTCTGCGCCGGCATGAACATACTCGTCGCGCTCTTC
ACCGAGATTCCGCGCTTTAAATGGGAGGACGCGGCTAGCGTTGGCTTCTTCATGCTCCTCCTCAACGCCCTCATC
GCCTTTATGCTCAACATCGCTAGTGTATTCCTGATCGGCAAGACGTCAGGCCTCGTCATGACGCTTAGTGGCATC
CTAAAGAATATTCTACTCATCGTTGTCTCAGTCATCATCTGGCGCACCGAGATCACTCCCCTCCAAGGCGTCGGC
TACACCATCGCCCTAGCCGGCCTCACCTACTACTCCGTAGGCTACGACCAGCTAGCCAAGTGCTCGCAAGGAGCC
GTCGCCTGGATGGCAGCCTCGATGCCGCCCTCTACCTCGACGCTACAGGCCCGCAGGCTCGTCCTCACCGCCATC
TTCGCCCTCACGGGTCTGTTGGTCCTGCTCGTCGGCCTGCAGCGCTTCGACGGGAGGACTGGGTATTCGCCCAGG
GTCGATGTTGGCACCGAGTGA
Transcript >Ophcf2|05864
ATGGCTCCGACGTCGTCTTCTTCGTCGTCAGCCGACGCCTCGCCCGTTGTCTCCCAATCATCAACCGAAGTCTTC
GACATGGGCTATGACGAGCAAGCAATTGATAAAGGGCCCGAGCCGTCGCCTTCCAAGGGCCTGCATCCCGCGCTA
TACATTGCGAATTGGATATTCTTCTCCAACCTCACCATATTGTTTAACAAATGGATTCTCGACTCTGCTGGCTTC
AGATACCCCATCCTCCTGACGTGCTGGCATCTCGTCTTCTCCGTCTTCGCTACCCAGATCCTCGCTCGTACGACG
ACACTGCTCGACTCGCGCCATAAGCTGCCCATGACGCCCCGTCTCTACCTCCGCACTATCTGCCCCATCGGCCTC
TTCTACTCGGGGTCTCTCGTCTGCTCCAACCTCGTGTATCTCTATCTCTCCGTCGCCTTTATCCAGATGCTCAAA
TCGGCCGCCCCAGTAGCCGTTCTCTTCGCTTCGTGGGCCTGGCGCGTCGCCGATCCGAGCCTGGACGCTCTGGTC
AACGTCCTCGTCATCGTCGCCGGCGTCGCCCTCGCCTCCTTTGGCGAGATACAATTTTCGCTCATCGGCTTCCTC
TACCAGCTAGGTGGCATCGTCTTCGAGGCTGTTCGCATTGTCATGATTCAGGTCATGCTCAGCGGCCAGGGCCTC
AACATGGACCCCATCGTCGGACTCTACTACTATGCCCCCGTCTGCGCCGGCATGAACATACTCGTCGCGCTCTTC
ACCGAGATTCCGCGCTTTAAATGGGAGGACGCGGCTAGCGTTGGCTTCTTCATGCTCCTCCTCAACGCCCTCATC
GCCTTTATGCTCAACATCGCTAGTGTATTCCTGATCGGCAAGACGTCAGGCCTCGTCATGACGCTTAGTGGCATC
CTAAAGAATATTCTACTCATCGTTGTCTCAGTCATCATCTGGCGCACCGAGATCACTCCCCTCCAAGGCGTCGGC
TACACCATCGCCCTAGCCGGCCTCACCTACTACTCCGTAGGCTACGACCAGCTAGCCAAGTGCTCGCAAGGAGCC
GTCGCCTGGATGGCAGCCTCGATGCCGCCCTCTACCTCGACGCTACAGGCCCGCAGGCTCGTCCTCACCGCCATC
TTCGCCCTCACGGGTCTGTTGGTCCTGCTCGTCGGCCTGCAGCGCTTCGACGGGAGGACTGGGTATTCGCCCAGG
GTCGATGTTGGCACCGAGTGA
Gene >Ophcf2|05864
ATGGCTCCGACGTCGTCTTCTTCGTCGTCAGCCGACGCCTCGCCCGTTGTCTCCCAATCATCAACCGAAGTCTTC
GACATGGGCTATGACGAGCAAGCAATTGATAAAGGGCCCGAGCCGTCGCCTTCCAAGGGCCTGCATCCCGCGCTA
TACATTGCGTACGACGCTTCGTTTCCTCCACGGTGCGCCGACCTCTTCCGCTGACTCTCTGTCACAGGAATTGGA
TATTCTTCTCCAACCTCACCATATTGTTTAACAAATGGATTCTCGACTCTGCTGGCTTCAGTGAGCTCCTCTTCC
TCCTCAGAAACCTCCGCAAGCTAACAGATCTCAACAGGATACCGTACGTCGTCTCCCCGAGCTTGGCCGACGGTG
AGGCTCTCGCTGACATGCATCGCAGCCATCCTCCTGACGTGCTGGCATCTCGTCTTCTCCGTCTTCGCTACCCAG
ATCCTCGCTCGTACGACGACACTGCTCGACTCGCGCCATAAGCTGCCCATGACGCCCCGTCTCTACCTCCGCACT
ATCTGCCCCATCGGCCTCTTCTACTCGGGGTCTCTCGTCTGCTCCAACCTCGTGTATCTCTATCTCTCCGTCGCC
TTTATCCAGATGCTCAAATCGGCCGCCCCAGTAGCCGTTCTCTTCGCTTCGTGGGCCTGGCGCGTCGCCGATCCG
AGCCTGGACGCTCTGGTCAACGTCCTCGTCATCGTCGCCGGCGTCGCCCTCGCCTCCTTTGGCGAGATACAATTT
TCGCTCATCGGCTTCCTCTACCAGCTAGGTGGCATCGTCTTCGAGGCTGTTCGCATTGTCATGATTCAGGTCATG
CTCAGCGGCCAGGGCCTCAACATGGACCCCATCGTCGGACTCTACTACTATGCCCCCGTCTGCGCCGGCATGAAC
ATACTCGTCGCGCTCTTCACCGAGATTCCGCGCTTTAAATGGGAGGACGCGGCTAGCGTTGGCTTCTTCATGCTC
CTCCTCAACGCCCTCATCGCCTTTATGCTCAACATCGCTAGTGTATTCCTGGTATGGCTTCACCCACCCGCGCGA
TCCCCTCCACATCAAGAGAAGCTAACCGTCGGGGTACCCACAGATCGGCAAGACGTCAGGCCTCGTCATGACGCT
TAGTGGCATCCTAAAGAATATTCTACTCATCGTTGTCTCAGTCATCATCTGGCGCACCGAGATCACTCCCCTCCA
AGGCGTCGGCTACACCATCGCCCTAGCCGGCCTCACCTACTACTCCGTAGGCTACGACCAGCTAGCCAAGTGCTC
GCAAGGAGCCGTCGCCTGGATGGCAGCCTCGATGCCGCCCTCTACCTCGACGCTACAGGCCCGCAGGCTCGTCCT
CACCGCCATCTTCGCCCTCACGGGTCTGTTGGTCCTGCTCGTCGGCCTGCAGCGCTTCGACGGGAGGACTGGGTA
TTCGCCCAGGGTCGATGTTGGCACCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail