Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05856
Gene name
Locationscaffold_06:2449205..2450236
Strand+
Gene length (bp)1031
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04934 Med6 MED6 mediator sub complex component 3.0E-38 12 164

GO

GO Term Description Terminal node
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0003712 transcription coregulator activity Yes
GO:0016592 mediator complex Yes
GO:0005575 cellular_component No
GO:0050794 regulation of cellular process No
GO:0080090 regulation of primary metabolic process No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0006355 regulation of transcription, DNA-templated No
GO:0031326 regulation of cellular biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0032991 protein-containing complex No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0003674 molecular_function No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0051252 regulation of RNA metabolic process No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0065007 biological regulation No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0008150 biological_process No
GO:0009889 regulation of biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6483 0.4869 0.1074 0.1352 0.0711 0.0081 0.0663 0.027 0.0825 0.0092

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4001
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2649
Ophiocordyceps australis map64 (Brazil) OphauB2|1626
Ophiocordyceps camponoti-floridani Ophcf2|05856 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|929
Ophiocordyceps kimflemingae Ophio5|2579
Ophiocordyceps subramaniannii Hirsu2|8029

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05856
MANPNEPPLDEIQWRSPPILAQMGGLHSNTILFYFAESPFFERTSNNAIIMSQAMNNMSMYHFIQTREAFEGRLK
TMSGLEFVVGEEPAETGPGMGTGVWVIRKQTRRKRYQEDDDIAIHASFFVVGENIYMAPSLSDILASRIMTISSA
LAKAMSAAESARKWRASTGHVYQLPTAQPASRHKTQLPSNGDDTPTGADTPAKLTAAPIPQKNDDVSLERTAEES
LFAHMRHGGEYIDENPITGRPGEFHLSSTGRKTVPPSKLGSGSIMGAMNGPTPDTKTDDKKDAKAVKSPKSPNMT
KPKRRKSKMSNGLSPAQTPTAS*
Coding >Ophcf2|05856
ATGGCCAACCCCAACGAACCGCCGCTGGACGAGATCCAGTGGCGCTCACCGCCGATCCTCGCTCAAATGGGTGGC
CTCCACTCCAACACCATCCTCTTCTACTTCGCCGAATCGCCCTTCTTCGAGCGCACGTCCAACAACGCCATCATC
ATGAGCCAGGCCATGAACAACATGTCCATGTACCACTTCATCCAGACCCGCGAGGCCTTTGAGGGCCGTCTGAAG
ACCATGTCGGGCCTCGAGTTTGTCGTTGGCGAGGAACCTGCAGAGACTGGGCCTGGCATGGGCACCGGCGTCTGG
GTCATTCGCAAGCAGACGCGGAGGAAGCGCTACCAGGAGGACGACGACATTGCCATTCATGCTTCTTTCTTCGTT
GTCGGCGAAAACATCTACATGGCACCCTCCTTGTCCGATATTCTTGCTTCGAGAATTATGACGATATCTTCGGCC
CTTGCAAAAGCAATGTCCGCTGCTGAAAGCGCCCGAAAGTGGCGTGCCTCTACAGGCCACGTATATCAGCTTCCA
ACAGCTCAGCCTGCCTCCCGTCACAAGACTCAGCTGCCGTCCAACGGCGACGACACCCCGACTGGCGCCGACACG
CCAGCCAAGCTGACAGCGGCTCCGATCCCTCAGAAGAACGACGACGTATCGCTGGAGAGGACGGCAGAGGAGTCT
CTCTTCGCTCATATGCGTCACGGCGGCGAGTACATCGACGAGAATCCCATCACGGGCCGTCCGGGCGAGTTCCAT
CTATCGTCGACCGGCCGCAAGACCGTGCCCCCATCCAAGCTCGGCTCCGGCTCCATCATGGGCGCCATGAACGGC
CCGACGCCTGACACGAAGACTGACGACAAGAAGGATGCCAAGGCGGTAAAGTCGCCCAAGTCGCCCAACATGACC
AAGCCTAAACGGCGGAAGAGCAAGATGAGCAACGGCTTGTCTCCGGCGCAGACTCCGACGGCGTCTTGA
Transcript >Ophcf2|05856
ATGGCCAACCCCAACGAACCGCCGCTGGACGAGATCCAGTGGCGCTCACCGCCGATCCTCGCTCAAATGGGTGGC
CTCCACTCCAACACCATCCTCTTCTACTTCGCCGAATCGCCCTTCTTCGAGCGCACGTCCAACAACGCCATCATC
ATGAGCCAGGCCATGAACAACATGTCCATGTACCACTTCATCCAGACCCGCGAGGCCTTTGAGGGCCGTCTGAAG
ACCATGTCGGGCCTCGAGTTTGTCGTTGGCGAGGAACCTGCAGAGACTGGGCCTGGCATGGGCACCGGCGTCTGG
GTCATTCGCAAGCAGACGCGGAGGAAGCGCTACCAGGAGGACGACGACATTGCCATTCATGCTTCTTTCTTCGTT
GTCGGCGAAAACATCTACATGGCACCCTCCTTGTCCGATATTCTTGCTTCGAGAATTATGACGATATCTTCGGCC
CTTGCAAAAGCAATGTCCGCTGCTGAAAGCGCCCGAAAGTGGCGTGCCTCTACAGGCCACGTATATCAGCTTCCA
ACAGCTCAGCCTGCCTCCCGTCACAAGACTCAGCTGCCGTCCAACGGCGACGACACCCCGACTGGCGCCGACACG
CCAGCCAAGCTGACAGCGGCTCCGATCCCTCAGAAGAACGACGACGTATCGCTGGAGAGGACGGCAGAGGAGTCT
CTCTTCGCTCATATGCGTCACGGCGGCGAGTACATCGACGAGAATCCCATCACGGGCCGTCCGGGCGAGTTCCAT
CTATCGTCGACCGGCCGCAAGACCGTGCCCCCATCCAAGCTCGGCTCCGGCTCCATCATGGGCGCCATGAACGGC
CCGACGCCTGACACGAAGACTGACGACAAGAAGGATGCCAAGGCGGTAAAGTCGCCCAAGTCGCCCAACATGACC
AAGCCTAAACGGCGGAAGAGCAAGATGAGCAACGGCTTGTCTCCGGCGCAGACTCCGACGGCGTCTTGA
Gene >Ophcf2|05856
ATGGCCAACCCCAACGAACCGCCGCTGGACGAGATCCAGTGGCGCTCACCGCCGATCCTCGCTCAAATGGGTGGC
CTCCACTCCAACACCATCCTCTTCTACTTCGCCGAATCGCCCTTCTTCGAGCGCACGTCCAACAACGCCATCATC
ATGAGCCAGGCCATGAACAACATGTCCATGTACCACTTCATCCAGACCCGCGAGGCCTTTGAGGGCCGTCTGAAG
ACCATGTCGGGCCTCGAGTTTGTCGTTGGCGAGGAACCTGCAGAGACTGGGCCTGGCATGGGCACCGGCGTCTGG
GTCATTCGCAAGCAGACGCGGAGGAAGCGCTACCAGGAGGACGACGACATTGCCATTCATGCTTCTTTCTTCGTT
GTCGGCGAAAACATCTACATGGCACCCTCCTTGTCCGATATTCTTGCTTCGAGAATTGTACCTTGTTCCCATCGT
GTCCCACCTCTCTATGAATTGCCTACTGAAACCTCTCCGCTCAGATGACGATATCTTCGGCCCTTGCAAAAGCAA
TGTCCGCTGCTGAAAGCGCCCGAAAGTGGCGTGCCTCTACAGGCCACGTATATCAGCTTCCAACAGCTCAGCCTG
CCTCCCGTCACAAGACTCAGCTGCCGTCCAACGGCGACGACACCCCGACTGGCGCCGACACGCCAGCCAAGCTGA
CAGCGGCTCCGATCCCTCAGAAGAACGACGACGTATCGCTGGAGAGGACGGCAGAGGAGTCTCTCTTCGCTCATA
TGCGTCACGGCGGCGAGTACATCGACGAGAATCCCATCACGGGCCGTCCGGGCGAGTTCCATCTATCGTCGACCG
GCCGCAAGACCGTGCCCCCATCCAAGCTCGGCTCCGGCTCCATCATGGGCGCCATGAACGGCCCGACGCCTGACA
CGAAGACTGACGACAAGAAGGATGCCAAGGCGGTAAAGTCGCCCAAGTCGCCCAACATGACCAAGCCTAAACGGC
GGAAGAGCAAGATGAGCAACGGCTTGTCTCCGGCGCAGACTCCGACGGCGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail