Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05854
Gene name
Locationscaffold_06:2440168..2441541
Strand+
Gene length (bp)1373
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01008 IF-2B Initiation factor 2 subunit family 8.1E-39 157 421

GO

GO Term Description Terminal node
GO:0044237 cellular metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0009987 cellular process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7564 0.4638 0.2157 0.0902 0.067 0.0851 0.0932 0.0514 0.0869 0.0004

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4003
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2645
Ophiocordyceps australis map64 (Brazil) OphauB2|5541
Ophiocordyceps camponoti-floridani Ophcf2|05854 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|925
Ophiocordyceps kimflemingae Ophio5|2575
Ophiocordyceps subramaniannii Hirsu2|8035

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05854
MAGESVPPAGDDKKRKKEQAQPESNPNDKKLSNAELKKKAKEDKAARRAAAKATQPASSAPPPLPHQQTANEPKN
SAGPARGTAAAAAAAPRPKHHHDGGARSTAKKTSKVPECFSHLSMARRLTLTQADKEVHPAVLALGQYMACFAIG
DSITRLEATLLALKKVIDAYTTPLGATLSRHFTSHVLNPQIEYLAACRPMCFSMGNAIRWLKLQISKLDIDLPDS
DAKKHLCALIDSFISERITVADFVMVNTAAEMVVDGDVIVVYARHHLVERALIRAHSVLARHFRVIVVDDPFHRV
GLGTAKALASAGLPVSYVSDLGALPTTLAGATVVMAAAEAMFANGAMYARAGTCDVVTVASHLGLRVVALCESIN
FTERVAVDSLTYNEIDPESCDAEGFRLLFDTTMNRYISVVVTELGTTSAKSVTAILRKLEEL*
Coding >Ophcf2|05854
ATGGCGGGCGAATCTGTCCCGCCTGCAGGCGACGACAAGAAGCGAAAGAAGGAACAGGCTCAACCCGAGTCAAAT
CCCAACGATAAAAAACTCTCCAACGCAGAGCTCAAGAAAAAGGCAAAGGAAGACAAGGCTGCCAGACGGGCTGCA
GCCAAAGCGACTCAGCCAGCCTCGTCTGCCCCCCCGCCGCTCCCCCATCAACAGACAGCAAACGAGCCCAAGAAT
AGCGCTGGACCTGCAAGAGGGACAGCAGCAGCAGCAGCAGCAGCACCGCGTCCCAAGCATCATCACGATGGCGGC
GCCCGGTCGACGGCGAAAAAAACCAGCAAAGTGCCCGAGTGCTTCAGCCATCTTTCAATGGCCCGACGCTTGACG
CTCACGCAGGCAGATAAAGAGGTTCATCCGGCGGTGTTGGCTCTGGGGCAGTACATGGCCTGCTTCGCCATCGGG
GATAGCATCACCAGACTCGAGGCTACGCTACTGGCCCTGAAAAAGGTCATCGACGCCTACACGACCCCCCTCGGC
GCCACACTCTCCCGACACTTCACCTCGCACGTTCTCAACCCGCAGATCGAATACCTAGCCGCCTGTCGCCCAATG
TGCTTCTCCATGGGCAACGCCATCCGCTGGCTGAAGCTACAAATCAGTAAGCTCGACATCGACCTTCCAGACTCA
GACGCAAAGAAACACCTCTGCGCCCTCATCGACAGCTTCATCAGCGAGCGCATCACCGTCGCAGATTTCGTCATG
GTCAACACAGCTGCCGAAATGGTAGTAGACGGCGACGTCATCGTCGTCTACGCTCGTCACCACCTCGTCGAACGC
GCTCTCATCCGCGCTCACTCCGTCCTCGCCCGCCACTTCCGCGTCATCGTCGTAGACGACCCCTTCCATCGCGTC
GGTCTCGGCACCGCAAAGGCCCTCGCCAGCGCAGGCCTACCCGTATCCTACGTCTCGGATCTAGGCGCCCTTCCC
ACCACACTGGCCGGCGCCACCGTCGTCATGGCCGCCGCTGAAGCCATGTTCGCAAACGGCGCCATGTACGCCCGC
GCCGGGACCTGCGACGTCGTCACCGTGGCCTCACATCTCGGCCTCCGCGTCGTGGCCCTATGCGAGAGCATCAAC
TTCACCGAGCGGGTTGCTGTCGACTCCCTCACTTACAACGAGATCGATCCGGAGAGCTGCGACGCAGAGGGCTTT
CGACTGCTGTTTGATACCACTATGAACCGCTACATTTCCGTCGTCGTCACCGAGCTGGGCACCACGTCTGCCAAG
TCGGTGACGGCCATTCTGCGGAAGCTGGAGGAGCTGTAG
Transcript >Ophcf2|05854
ATGGCGGGCGAATCTGTCCCGCCTGCAGGCGACGACAAGAAGCGAAAGAAGGAACAGGCTCAACCCGAGTCAAAT
CCCAACGATAAAAAACTCTCCAACGCAGAGCTCAAGAAAAAGGCAAAGGAAGACAAGGCTGCCAGACGGGCTGCA
GCCAAAGCGACTCAGCCAGCCTCGTCTGCCCCCCCGCCGCTCCCCCATCAACAGACAGCAAACGAGCCCAAGAAT
AGCGCTGGACCTGCAAGAGGGACAGCAGCAGCAGCAGCAGCAGCACCGCGTCCCAAGCATCATCACGATGGCGGC
GCCCGGTCGACGGCGAAAAAAACCAGCAAAGTGCCCGAGTGCTTCAGCCATCTTTCAATGGCCCGACGCTTGACG
CTCACGCAGGCAGATAAAGAGGTTCATCCGGCGGTGTTGGCTCTGGGGCAGTACATGGCCTGCTTCGCCATCGGG
GATAGCATCACCAGACTCGAGGCTACGCTACTGGCCCTGAAAAAGGTCATCGACGCCTACACGACCCCCCTCGGC
GCCACACTCTCCCGACACTTCACCTCGCACGTTCTCAACCCGCAGATCGAATACCTAGCCGCCTGTCGCCCAATG
TGCTTCTCCATGGGCAACGCCATCCGCTGGCTGAAGCTACAAATCAGTAAGCTCGACATCGACCTTCCAGACTCA
GACGCAAAGAAACACCTCTGCGCCCTCATCGACAGCTTCATCAGCGAGCGCATCACCGTCGCAGATTTCGTCATG
GTCAACACAGCTGCCGAAATGGTAGTAGACGGCGACGTCATCGTCGTCTACGCTCGTCACCACCTCGTCGAACGC
GCTCTCATCCGCGCTCACTCCGTCCTCGCCCGCCACTTCCGCGTCATCGTCGTAGACGACCCCTTCCATCGCGTC
GGTCTCGGCACCGCAAAGGCCCTCGCCAGCGCAGGCCTACCCGTATCCTACGTCTCGGATCTAGGCGCCCTTCCC
ACCACACTGGCCGGCGCCACCGTCGTCATGGCCGCCGCTGAAGCCATGTTCGCAAACGGCGCCATGTACGCCCGC
GCCGGGACCTGCGACGTCGTCACCGTGGCCTCACATCTCGGCCTCCGCGTCGTGGCCCTATGCGAGAGCATCAAC
TTCACCGAGCGGGTTGCTGTCGACTCCCTCACTTACAACGAGATCGATCCGGAGAGCTGCGACGCAGAGGGCTTT
CGACTGCTGTTTGATACCACTATGAACCGCTACATTTCCGTCGTCGTCACCGAGCTGGGCACCACGTCTGCCAAG
TCGGTGACGGCCATTCTGCGGAAGCTGGAGGAGCTGTAG
Gene >Ophcf2|05854
ATGGCGGGCGAATCTGTCCCGCCTGCAGGCGACGACAAGAAGCGAAAGAAGGAACAGGCTCAACCCGAGTCAAAT
CCCAACGATAAAAAACTCTCCAACGCAGAGCTCAAGAAAAAGGCAAAGGAAGACAAGGCTGCCAGACGGGCTGCA
GCCAAAGCGACTCAGCCAGCCTCGTCTGCCCCCCCGCCGCTCCCCCATCAACAGACAGCAAACGAGCCCAAGAAT
AGCGCTGGACCTGCAAGAGGGACAGCAGCAGCAGCAGCAGCAGCACCGCGTCCCAAGCATCATCACGATGGCGGC
GCCCGGTCGACGGCGAAAAAAACCAGCAAAGTGCCCGAGTGCTTCAGCCATCTTTCAATGGCCCGACGCTTGACG
CTCACGCAGGCAGATAAAGAGGTTCATCCGGCGGTGTTGGCTCTGGGGCAGTACATGGCCTGCTTCGCCATCGGG
GATAGCATCACCAGACTCGAGGCTACGCTACTGGCCCTGAAAAAGGTCGGCAGCCCTCTCTTTCGTCCTGCATCC
ATGGAAGACTAACGACTCCCTCCTCGCAGGTCATCGACGCCTACACGACCCCCCTCGGCGCCACACTCTCCCGAC
ACTTCACCTCGCACGTTCTCAACCCGCAGATCGAATACCTAGCCGCCTGTCGCCCAATGTGCTTCTCCATGGGCA
ACGCCATCCGCTGGCTGAAGCTACAAATCAGTAAGCTCGACATCGACCTTCCAGACTCAGACGCAAAGAAACACC
TCTGCGCCCTCATCGACAGCTTCATCAGCGAGCGCATCACCGTCGCAGATTTCGTCATGGTCAACACAGCTGCCG
AAATGGTAGTAGACGGCGACGTCATCGTCGTCTACGCTCGTCACCACCTCGTCGAACGCGCTCTCATCCGCGCTC
ACTCCGTCCTCGCCCGCCACTTCCGCGTCATCGTCGTAGACGACCCCTTCCATCGCGTCGGTCTCGGCACCGCAA
AGGCCCTCGCCAGCGCAGGCCTACCCGTATCCTACGTCTCGGATCTAGGCGCCCTTCCCACCACACTGGCCGGCG
CCACCGTCGTCATGGCCGCCGCTGAAGCCATGTTCGCAAACGGCGCCATGTACGCCCGCGCCGGGACCTGCGACG
TCGTCACCGTGGCCTCACATCTCGGCCTCCGCGTCGTGGCCCTATGCGAGAGCATCAACTTCACCGAGCGGGTTG
CTGTCGACTCCCTCACTTACAACGAGATCGATCCGGAGAGCTGCGACGCAGAGGGCTTTCGACTGCTGTTTGATA
CCACTATGAACCGCTACATTTCCGTCGTCGTCACCGAGCTGGGCACCACGTCTGCCAAGTCGGTGACGGCCATTC
TGCGGAAGCTGGAGGAGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail