Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05851
Gene name
Locationscaffold_06:2435414..2436822
Strand+
Gene length (bp)1408
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01960 ArgJ ArgJ family 1.3E-143 41 452

GO

GO Term Description Terminal node
GO:0004358 glutamate N-acetyltransferase activity Yes
GO:0006526 arginine biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0006525 arginine metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0016746 acyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0016410 N-acyltransferase activity No
GO:0016407 acetyltransferase activity No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0009084 glutamine family amino acid biosynthetic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0008080 N-acetyltransferase activity No
GO:0009064 glutamine family amino acid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0044281 small molecule metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0016053 organic acid biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2517 0.1726 0.0859 0.0253 0.9314 0.1163 0.0262 0.0745 0.0375 0.0797

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4937
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2664
Ophiocordyceps australis map64 (Brazil) OphauB2|1611
Ophiocordyceps camponoti-floridani Ophcf2|05851 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|922
Ophiocordyceps kimflemingae Ophio5|7065
Ophiocordyceps subramaniannii Hirsu2|179

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05851
MLSVSKSFSRLYSALPSSKGIPPSKARWVPTSGVYPQGFRASGVYVGVKPTNLDKPDLALVSSDRPCAAAAVFTK
NKFRAAPVTFCRKLLEAKDNAGLRSVIVNSGNANAVTGARALEDAAKMASTTDERVGCRDSTLVMSTGVIGQRLP
IKKILDNIPVAYHNLGKSHESWIKCADAIRTTDSFPKLLSRSFELPSSPGVECRIAGMSKGAGMVNPNMATLLGI
MVTDAPIEPWVIKPMLQYAVDRSFNAITIDGDTSTNDTVALLANGATRAKAISHEDSPDYLVMRQVLTDFAADLA
KYVVRDGEGCTKFITIRVVDSATLEAARAIARAIAVSPLVKTALHGGDANWGRILCAVGYSLITPPGQAEIDVPE
IDPARTNVSFMPSDGSPELKLLVDGEPEAVDEKRAAQILEAEELEIVVRLGTGSESVLHWTCDLSHEYVTINSDY
RT*
Coding >Ophcf2|05851
ATGCTGAGCGTTTCCAAATCCTTCTCCCGCCTCTACAGCGCCCTTCCGTCGTCAAAGGGCATCCCACCGTCCAAG
GCCAGGTGGGTGCCGACGTCAGGCGTCTATCCCCAGGGCTTCCGAGCCTCGGGCGTCTACGTCGGAGTCAAGCCG
ACGAATCTCGACAAGCCCGATCTCGCTCTCGTCTCGTCGGATCGGCCCTGTGCCGCCGCCGCCGTCTTCACCAAG
AATAAGTTTCGCGCCGCGCCCGTTACCTTTTGCCGCAAGCTGCTCGAGGCCAAGGACAATGCTGGTCTGCGGAGC
GTCATCGTCAATTCGGGAAACGCCAATGCCGTTACCGGTGCTAGGGCCCTTGAGGATGCTGCAAAGATGGCCAGC
ACTACGGACGAGCGCGTTGGATGTCGGGACTCGACGCTTGTCATGAGCACCGGCGTCATTGGGCAACGTCTCCCC
ATCAAGAAGATCCTCGACAACATCCCCGTCGCCTACCACAACCTCGGAAAATCTCACGAGAGCTGGATCAAGTGT
GCCGACGCCATCCGCACCACCGACTCCTTCCCCAAGCTGCTATCCCGTTCGTTCGAGCTTCCGTCATCACCGGGC
GTCGAGTGTCGTATCGCCGGCATGTCGAAAGGCGCTGGAATGGTCAATCCAAACATGGCGACGCTGCTGGGCATC
ATGGTGACGGATGCGCCCATCGAGCCCTGGGTCATCAAGCCCATGCTCCAGTACGCCGTCGACCGGTCATTCAAC
GCCATCACCATCGATGGTGACACGTCTACAAATGACACTGTCGCCCTACTGGCCAACGGCGCGACCAGGGCAAAG
GCCATCTCACACGAGGACTCTCCCGATTACCTCGTCATGCGCCAAGTCCTGACCGACTTCGCCGCCGACCTGGCC
AAGTACGTGGTCCGCGACGGCGAGGGATGCACAAAGTTCATCACCATTCGTGTCGTCGATTCCGCCACACTCGAA
GCCGCCCGTGCCATCGCCCGTGCCATCGCCGTCTCGCCGCTCGTCAAGACGGCTCTCCACGGCGGAGACGCCAAC
TGGGGACGCATACTATGCGCCGTCGGCTACTCGCTCATCACGCCCCCGGGTCAGGCCGAGATCGACGTTCCCGAG
ATCGACCCAGCCCGGACAAACGTCTCCTTCATGCCGTCGGACGGCTCGCCCGAGCTCAAGTTGCTGGTCGATGGG
GAGCCCGAGGCCGTGGACGAGAAGAGAGCCGCTCAGATCCTCGAGGCGGAAGAGCTGGAGATTGTCGTCCGGCTC
GGGACGGGCTCCGAAAGCGTCCTTCACTGGACCTGTGATCTGAGCCACGAATACGTGACGATCAACAGCGACTAT
CGCACTTAG
Transcript >Ophcf2|05851
ATGCTGAGCGTTTCCAAATCCTTCTCCCGCCTCTACAGCGCCCTTCCGTCGTCAAAGGGCATCCCACCGTCCAAG
GCCAGGTGGGTGCCGACGTCAGGCGTCTATCCCCAGGGCTTCCGAGCCTCGGGCGTCTACGTCGGAGTCAAGCCG
ACGAATCTCGACAAGCCCGATCTCGCTCTCGTCTCGTCGGATCGGCCCTGTGCCGCCGCCGCCGTCTTCACCAAG
AATAAGTTTCGCGCCGCGCCCGTTACCTTTTGCCGCAAGCTGCTCGAGGCCAAGGACAATGCTGGTCTGCGGAGC
GTCATCGTCAATTCGGGAAACGCCAATGCCGTTACCGGTGCTAGGGCCCTTGAGGATGCTGCAAAGATGGCCAGC
ACTACGGACGAGCGCGTTGGATGTCGGGACTCGACGCTTGTCATGAGCACCGGCGTCATTGGGCAACGTCTCCCC
ATCAAGAAGATCCTCGACAACATCCCCGTCGCCTACCACAACCTCGGAAAATCTCACGAGAGCTGGATCAAGTGT
GCCGACGCCATCCGCACCACCGACTCCTTCCCCAAGCTGCTATCCCGTTCGTTCGAGCTTCCGTCATCACCGGGC
GTCGAGTGTCGTATCGCCGGCATGTCGAAAGGCGCTGGAATGGTCAATCCAAACATGGCGACGCTGCTGGGCATC
ATGGTGACGGATGCGCCCATCGAGCCCTGGGTCATCAAGCCCATGCTCCAGTACGCCGTCGACCGGTCATTCAAC
GCCATCACCATCGATGGTGACACGTCTACAAATGACACTGTCGCCCTACTGGCCAACGGCGCGACCAGGGCAAAG
GCCATCTCACACGAGGACTCTCCCGATTACCTCGTCATGCGCCAAGTCCTGACCGACTTCGCCGCCGACCTGGCC
AAGTACGTGGTCCGCGACGGCGAGGGATGCACAAAGTTCATCACCATTCGTGTCGTCGATTCCGCCACACTCGAA
GCCGCCCGTGCCATCGCCCGTGCCATCGCCGTCTCGCCGCTCGTCAAGACGGCTCTCCACGGCGGAGACGCCAAC
TGGGGACGCATACTATGCGCCGTCGGCTACTCGCTCATCACGCCCCCGGGTCAGGCCGAGATCGACGTTCCCGAG
ATCGACCCAGCCCGGACAAACGTCTCCTTCATGCCGTCGGACGGCTCGCCCGAGCTCAAGTTGCTGGTCGATGGG
GAGCCCGAGGCCGTGGACGAGAAGAGAGCCGCTCAGATCCTCGAGGCGGAAGAGCTGGAGATTGTCGTCCGGCTC
GGGACGGGCTCCGAAAGCGTCCTTCACTGGACCTGTGATCTGAGCCACGAATACGTGACGATCAACAGCGACTAT
CGCACTTAG
Gene >Ophcf2|05851
ATGCTGAGCGTTTCCAAATCCTTCTCCCGCCTCTACAGCGCCCTTCCGTCGTCAAAGGGCATCCCACCGTCCAAG
GCCAGGTGGGTGCCGACGTCAGGCGTCTATCCCCAGGGCTTCCGAGCCTCGGGCGTCTACGTCGGAGTCAAGCCG
ACGAATCTCGACAAGCCCGATCTCGCTCTCGTCTCGTCGGATCGGCCCTGTGCCGCCGCCGCCGTCTTCACCAAG
AATAAGTTTCGCGCCGCGCCCGTTACCTTTTGCCGCAAGCTGCTCGAGGCCAAGGACAATGCTGGTCTGCGGAGC
GTCATCGTCAATTCGGGAAACGCCAATGCCGTTACCGGTGCTAGGGCCCTTGAGGATGCTGCAAAGATGGCCAGC
ACTACGGACGAGCGCGTTGGATGTCGGGACTCGACGCTTGTCATGAGCACCGGCGTCATTGGGCAACGGTGAGAT
GGACATGTCCCTGATCCTTCCTTCATCGCTGACGCCTTCAAGTCTCCCCATCAAGAAGATCCTCGACAACATCCC
CGTCGCCTACCACAACCTCGGAAAATCTCACGAGAGCTGGATCAAGTGTGCCGACGCCATCCGCACCACCGACTC
CTTCCCCAAGCTGCTATCCCGTTCGTTCGAGCTTCCGTCATCACCGGGCGTCGAGTGTCGTATCGCCGGCATGTC
GAAAGGCGCTGGAATGGTCAATCCAAACATGGCGACGCTGCTGGGCATCATGGTGACGGATGCGCCCATCGAGCC
CTGGGTCATCAAGCCCATGCTCCAGTACGCCGTCGACCGGTCATTCAACGCCATCACCATCGATGGTGACACGTC
TACAAATGACACTGTCGCCCTACTGGCCAACGGCGCGACCAGGGCAAAGGCCATCTCACACGAGGACTCTCCCGA
TTACCTCGTCATGCGCCAAGTCCTGACCGACTTCGCCGCCGACCTGGCCAAGTACGTGGTCCGCGACGGCGAGGG
ATGCACAAAGTTCATCACCATTCGTGTCGTCGATTCCGCCACACTCGAAGCCGCCCGTGCCATCGCCCGTGCCAT
CGCCGTCTCGCCGCTCGTCAAGACGGCTCTCCACGGCGGAGACGCCAACTGGGGACGCATACTATGCGCCGTCGG
CTACTCGCTCATCACGCCCCCGGGTCAGGCCGAGATCGACGTTCCCGAGATCGACCCAGCCCGGACAAACGTCTC
CTTCATGCCGTCGGACGGCTCGCCCGAGCTCAAGTTGCTGGTCGATGGGGAGCCCGAGGCCGTGGACGAGAAGAG
AGCCGCTCAGATCCTCGAGGCGGAAGAGCTGGAGATTGTCGTCCGGCTCGGGACGGGCTCCGAAAGCGTCCTTCA
CTGGACCTGTGATCTGAGCCACGAATACGTGACGATCAACAGCGACTATCGCACTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail