Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05846
Gene name
Locationscaffold_06:2412161..2413418
Strand-
Gene length (bp)1257
Transcript length (bp)1257
Coding sequence length (bp)1257
Protein length (aa) 419

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0882 0.0944 0.964 0.1013 0.0563 0.0087 0.0717 0.1129 0.0943 0.0013

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999641

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA11 3.8E-78 18 215

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4007
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|1375
Ophiocordyceps camponoti-floridani Ophcf2|05846 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3275
Ophiocordyceps kimflemingae Ophio5|5058
Ophiocordyceps subramaniannii Hirsu2|8041

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05846
MLVQALALAGLAASASAHILISNPVPYGKDSLNNSPLLADGSDFPCKQRTGVYDTAGASNVYKQGSTQQLEFRGS
AVHGGGSCQVSLTTDLKPTKNSVWKVIKSIEGGCPAKNQGGNMGGGAGADTPFKYDFTIPSELASGNYTLAWTWF
NKIGNREMYMNCAPVSVTGSGGSGGFLNSLPDMFVANLGKGGCGTKEGTDVQFPNPGKDVDRFNGATSAFAPPVG
SCPTGSSDGGNGGYQPPAPTKAAKPEQDTPVQPTQTPSAGNGPPIPQASNSVPGAVFATVSADSPKAPAPTSDSS
PPSPQTSPCLGPPRRQRPPNAPAEPPSQQPPPPSQQPPAGPSNGTAPAGVHPAGTSCSPEGTWNCIAGKSFQRCA
SGMWSVPQDMAAGTACAPGEAPDLKMSAASVRRSLGRRFRYVA*
Coding >Ophcf2|05846
ATGCTCGTCCAAGCCCTCGCCCTCGCCGGCCTCGCCGCCTCAGCCAGCGCCCACATCCTCATCAGCAACCCGGTC
CCCTACGGCAAAGACAGCCTCAACAACAGCCCCCTGCTGGCCGACGGCTCCGACTTCCCCTGCAAGCAGCGCACC
GGCGTCTACGACACGGCCGGCGCCAGCAACGTCTACAAGCAGGGCAGCACCCAGCAGCTCGAGTTCCGCGGCTCG
GCCGTCCACGGGGGCGGCTCGTGCCAAGTCTCCCTGACGACGGACCTCAAGCCCACCAAGAACTCGGTCTGGAAG
GTCATCAAGTCCATCGAGGGAGGCTGCCCGGCCAAGAACCAGGGCGGTAACATGGGCGGAGGCGCGGGCGCCGAC
ACCCCGTTCAAGTACGACTTCACCATCCCCTCCGAGCTGGCGTCCGGCAACTATACGCTGGCCTGGACCTGGTTC
AACAAGATCGGCAACCGGGAGATGTACATGAACTGCGCCCCCGTCTCCGTCACGGGTTCCGGAGGCTCGGGCGGC
TTCCTCAACTCTCTTCCGGACATGTTCGTCGCCAACCTCGGCAAGGGAGGCTGTGGAACCAAGGAGGGAACCGAC
GTCCAGTTCCCCAACCCGGGCAAGGACGTCGACCGCTTCAACGGTGCCACCTCGGCCTTTGCTCCTCCCGTCGGC
TCGTGCCCGACTGGCAGCTCCGACGGCGGTAACGGCGGCTACCAGCCTCCGGCCCCGACCAAGGCCGCCAAGCCC
GAGCAGGACACTCCCGTCCAGCCAACCCAGACCCCTTCAGCCGGCAACGGTCCTCCGATCCCGCAGGCCTCCAAC
AGCGTCCCCGGCGCCGTCTTCGCCACCGTCAGCGCCGACTCCCCCAAGGCCCCGGCCCCGACCTCGGACTCGTCC
CCTCCAAGCCCGCAGACCAGCCCTTGTCTCGGCCCCCCGCGGCGCCAACGACCCCCCAACGCTCCGGCCGAGCCT
CCGTCTCAGCAGCCTCCTCCTCCTTCCCAGCAGCCCCCCGCCGGTCCCAGCAACGGCACCGCCCCGGCCGGCGTC
CATCCCGCCGGCACCTCATGCTCCCCCGAGGGGACCTGGAACTGCATCGCCGGCAAGTCCTTCCAGCGCTGCGCA
AGCGGCATGTGGTCCGTCCCCCAGGACATGGCCGCCGGCACCGCCTGCGCCCCCGGCGAGGCGCCAGACCTCAAG
ATGTCCGCTGCCAGCGTCCGGCGCTCCCTCGGCCGACGATTCCGCTACGTCGCCTAA
Transcript >Ophcf2|05846
ATGCTCGTCCAAGCCCTCGCCCTCGCCGGCCTCGCCGCCTCAGCCAGCGCCCACATCCTCATCAGCAACCCGGTC
CCCTACGGCAAAGACAGCCTCAACAACAGCCCCCTGCTGGCCGACGGCTCCGACTTCCCCTGCAAGCAGCGCACC
GGCGTCTACGACACGGCCGGCGCCAGCAACGTCTACAAGCAGGGCAGCACCCAGCAGCTCGAGTTCCGCGGCTCG
GCCGTCCACGGGGGCGGCTCGTGCCAAGTCTCCCTGACGACGGACCTCAAGCCCACCAAGAACTCGGTCTGGAAG
GTCATCAAGTCCATCGAGGGAGGCTGCCCGGCCAAGAACCAGGGCGGTAACATGGGCGGAGGCGCGGGCGCCGAC
ACCCCGTTCAAGTACGACTTCACCATCCCCTCCGAGCTGGCGTCCGGCAACTATACGCTGGCCTGGACCTGGTTC
AACAAGATCGGCAACCGGGAGATGTACATGAACTGCGCCCCCGTCTCCGTCACGGGTTCCGGAGGCTCGGGCGGC
TTCCTCAACTCTCTTCCGGACATGTTCGTCGCCAACCTCGGCAAGGGAGGCTGTGGAACCAAGGAGGGAACCGAC
GTCCAGTTCCCCAACCCGGGCAAGGACGTCGACCGCTTCAACGGTGCCACCTCGGCCTTTGCTCCTCCCGTCGGC
TCGTGCCCGACTGGCAGCTCCGACGGCGGTAACGGCGGCTACCAGCCTCCGGCCCCGACCAAGGCCGCCAAGCCC
GAGCAGGACACTCCCGTCCAGCCAACCCAGACCCCTTCAGCCGGCAACGGTCCTCCGATCCCGCAGGCCTCCAAC
AGCGTCCCCGGCGCCGTCTTCGCCACCGTCAGCGCCGACTCCCCCAAGGCCCCGGCCCCGACCTCGGACTCGTCC
CCTCCAAGCCCGCAGACCAGCCCTTGTCTCGGCCCCCCGCGGCGCCAACGACCCCCCAACGCTCCGGCCGAGCCT
CCGTCTCAGCAGCCTCCTCCTCCTTCCCAGCAGCCCCCCGCCGGTCCCAGCAACGGCACCGCCCCGGCCGGCGTC
CATCCCGCCGGCACCTCATGCTCCCCCGAGGGGACCTGGAACTGCATCGCCGGCAAGTCCTTCCAGCGCTGCGCA
AGCGGCATGTGGTCCGTCCCCCAGGACATGGCCGCCGGCACCGCCTGCGCCCCCGGCGAGGCGCCAGACCTCAAG
ATGTCCGCTGCCAGCGTCCGGCGCTCCCTCGGCCGACGATTCCGCTACGTCGCCTAA
Gene >Ophcf2|05846
ATGCTCGTCCAAGCCCTCGCCCTCGCCGGCCTCGCCGCCTCAGCCAGCGCCCACATCCTCATCAGCAACCCGGTC
CCCTACGGCAAAGACAGCCTCAACAACAGCCCCCTGCTGGCCGACGGCTCCGACTTCCCCTGCAAGCAGCGCACC
GGCGTCTACGACACGGCCGGCGCCAGCAACGTCTACAAGCAGGGCAGCACCCAGCAGCTCGAGTTCCGCGGCTCG
GCCGTCCACGGGGGCGGCTCGTGCCAAGTCTCCCTGACGACGGACCTCAAGCCCACCAAGAACTCGGTCTGGAAG
GTCATCAAGTCCATCGAGGGAGGCTGCCCGGCCAAGAACCAGGGCGGTAACATGGGCGGAGGCGCGGGCGCCGAC
ACCCCGTTCAAGTACGACTTCACCATCCCCTCCGAGCTGGCGTCCGGCAACTATACGCTGGCCTGGACCTGGTTC
AACAAGATCGGCAACCGGGAGATGTACATGAACTGCGCCCCCGTCTCCGTCACGGGTTCCGGAGGCTCGGGCGGC
TTCCTCAACTCTCTTCCGGACATGTTCGTCGCCAACCTCGGCAAGGGAGGCTGTGGAACCAAGGAGGGAACCGAC
GTCCAGTTCCCCAACCCGGGCAAGGACGTCGACCGCTTCAACGGTGCCACCTCGGCCTTTGCTCCTCCCGTCGGC
TCGTGCCCGACTGGCAGCTCCGACGGCGGTAACGGCGGCTACCAGCCTCCGGCCCCGACCAAGGCCGCCAAGCCC
GAGCAGGACACTCCCGTCCAGCCAACCCAGACCCCTTCAGCCGGCAACGGTCCTCCGATCCCGCAGGCCTCCAAC
AGCGTCCCCGGCGCCGTCTTCGCCACCGTCAGCGCCGACTCCCCCAAGGCCCCGGCCCCGACCTCGGACTCGTCC
CCTCCAAGCCCGCAGACCAGCCCTTGTCTCGGCCCCCCGCGGCGCCAACGACCCCCCAACGCTCCGGCCGAGCCT
CCGTCTCAGCAGCCTCCTCCTCCTTCCCAGCAGCCCCCCGCCGGTCCCAGCAACGGCACCGCCCCGGCCGGCGTC
CATCCCGCCGGCACCTCATGCTCCCCCGAGGGGACCTGGAACTGCATCGCCGGCAAGTCCTTCCAGCGCTGCGCA
AGCGGCATGTGGTCCGTCCCCCAGGACATGGCCGCCGGCACCGCCTGCGCCCCCGGCGAGGCGCCAGACCTCAAG
ATGTCCGCTGCCAGCGTCCGGCGCTCCCTCGGCCGACGATTCCGCTACGTCGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail