Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05845
Gene name
Locationscaffold_06:2409122..2410767
Strand+
Gene length (bp)1645
Transcript length (bp)1527
Coding sequence length (bp)1527
Protein length (aa) 509

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09346 SMI1_KNR4 SMI1 / KNR4 family (SUKH-1) 1.3E-31 142 323

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5939 0.3008 0.0867 0.1815 0.2272 0.0093 0.1524 0.2526 0.4294 0.0471

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2036
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4016
Ophiocordyceps australis map64 (Brazil) OphauB2|1376
Ophiocordyceps camponoti-floridani Ophcf2|05845 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|654
Ophiocordyceps kimflemingae Ophio5|299
Ophiocordyceps subramaniannii Hirsu2|2319

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05845
MESSGFGSALRSFWHTMTSYDRHSSYHSPHRTGRHVPLQNNRVGILTGVATASDSHADVSYPYSDDGGRSSPPAA
RGSYSPGMRSAAVKQSDGFEVQSPGDVPMQSFSDGLPPPPPVSHSWKRIDAWAEDNYPELFDQLCEGATTNDLND
LEHQLDCSLPQDIRESLAIHDGQERGGNPTGIIFSSMLLDCEEIVQEWETWRTVNQQLLIDAANATPATPSKLSA
GSNEASSSRQRPLSSSSASTSDEWRQSLLARQDSVPPKAVQRAYAHMGWIPLVRDWGGNNLAVDLAPGPNGRWGQ
IILFGRDYDTKYVVARSWAAFLALVADDLNSGKWFVDDETGELKLREFKETRVEPAYFSILRWRMDQKHGRRAAK
RASMAPTKTGSPLASRSASPYASPTELNGDVRGRTAQRLSGSSPLSSPMNPPAYLKPLPLSRVTEEMSIPEMPSA
FIEPSQLVEVETLDDMDRGKNALRISTVACADSDEMLSSKVNGKQPAMGDGVLKTIEI*
Coding >Ophcf2|05845
ATGGAGAGCTCCGGCTTCGGTTCCGCCCTGCGCTCCTTCTGGCACACCATGACCAGCTACGATCGACACTCCTCA
TATCACTCCCCGCACAGGACCGGCCGCCATGTCCCTCTGCAAAATAATCGCGTCGGCATTCTCACGGGCGTTGCG
ACCGCCTCCGACTCTCACGCCGATGTCAGCTACCCATACTCAGACGATGGCGGACGCTCCTCGCCCCCAGCCGCC
CGCGGTTCATACTCTCCCGGCATGCGATCCGCCGCCGTCAAGCAGTCGGACGGTTTTGAGGTCCAGAGCCCGGGC
GACGTGCCCATGCAATCATTCAGTGATGGACTGCCGCCCCCGCCCCCCGTTAGCCACTCGTGGAAGCGCATAGAT
GCCTGGGCCGAAGACAACTACCCGGAACTGTTCGATCAACTGTGCGAGGGCGCCACCACCAACGATCTCAACGAT
CTCGAGCATCAGCTCGACTGCTCTCTCCCTCAAGACATCCGCGAGTCTCTTGCCATCCACGACGGCCAGGAGCGA
GGCGGTAATCCGACGGGAATCATCTTCAGCTCCATGCTGTTGGACTGCGAGGAGATTGTCCAAGAATGGGAGACG
TGGCGTACGGTCAACCAGCAGCTGCTGATTGATGCCGCCAACGCGACGCCCGCGACGCCCTCGAAGCTCTCAGCC
GGCAGCAACGAAGCCTCCTCATCGCGACAGCGGCCCCTGTCATCGTCGTCGGCCAGCACGAGCGACGAGTGGCGT
CAGAGCCTGTTGGCCCGCCAGGACTCGGTCCCGCCCAAGGCGGTGCAGAGGGCTTACGCCCATATGGGCTGGATC
CCTCTGGTTCGAGACTGGGGCGGCAACAACCTGGCGGTCGACTTGGCGCCGGGGCCCAACGGTCGCTGGGGTCAG
ATCATTCTGTTCGGCCGCGACTATGACACCAAATACGTCGTGGCCCGCTCTTGGGCAGCCTTTCTGGCCCTCGTT
GCCGACGACCTCAATAGCGGCAAGTGGTTCGTCGACGACGAAACCGGCGAGCTCAAACTGAGGGAGTTTAAGGAG
ACGCGGGTTGAGCCGGCCTACTTTTCCATTCTGCGATGGAGGATGGACCAGAAGCACGGGCGGAGGGCGGCCAAG
CGGGCATCGATGGCGCCGACCAAGACGGGCTCGCCCCTGGCCTCGCGGTCGGCCTCGCCCTATGCCAGTCCGACG
GAGCTCAATGGCGACGTGCGGGGGAGAACGGCGCAGCGGTTGAGCGGCTCGTCTCCGCTCTCGAGCCCGATGAAC
CCGCCGGCATACCTGAAGCCGCTGCCACTCAGCCGGGTGACGGAGGAGATGTCGATTCCGGAGATGCCGAGCGCC
TTCATCGAGCCCAGTCAACTGGTCGAGGTGGAGACGCTGGACGACATGGATCGGGGCAAGAATGCGCTGCGCATC
TCGACTGTTGCCTGCGCCGACTCGGACGAAATGCTGTCGAGCAAGGTCAACGGAAAGCAGCCTGCCATGGGAGAT
GGCGTTCTCAAGACGATTGAGATTTGA
Transcript >Ophcf2|05845
ATGGAGAGCTCCGGCTTCGGTTCCGCCCTGCGCTCCTTCTGGCACACCATGACCAGCTACGATCGACACTCCTCA
TATCACTCCCCGCACAGGACCGGCCGCCATGTCCCTCTGCAAAATAATCGCGTCGGCATTCTCACGGGCGTTGCG
ACCGCCTCCGACTCTCACGCCGATGTCAGCTACCCATACTCAGACGATGGCGGACGCTCCTCGCCCCCAGCCGCC
CGCGGTTCATACTCTCCCGGCATGCGATCCGCCGCCGTCAAGCAGTCGGACGGTTTTGAGGTCCAGAGCCCGGGC
GACGTGCCCATGCAATCATTCAGTGATGGACTGCCGCCCCCGCCCCCCGTTAGCCACTCGTGGAAGCGCATAGAT
GCCTGGGCCGAAGACAACTACCCGGAACTGTTCGATCAACTGTGCGAGGGCGCCACCACCAACGATCTCAACGAT
CTCGAGCATCAGCTCGACTGCTCTCTCCCTCAAGACATCCGCGAGTCTCTTGCCATCCACGACGGCCAGGAGCGA
GGCGGTAATCCGACGGGAATCATCTTCAGCTCCATGCTGTTGGACTGCGAGGAGATTGTCCAAGAATGGGAGACG
TGGCGTACGGTCAACCAGCAGCTGCTGATTGATGCCGCCAACGCGACGCCCGCGACGCCCTCGAAGCTCTCAGCC
GGCAGCAACGAAGCCTCCTCATCGCGACAGCGGCCCCTGTCATCGTCGTCGGCCAGCACGAGCGACGAGTGGCGT
CAGAGCCTGTTGGCCCGCCAGGACTCGGTCCCGCCCAAGGCGGTGCAGAGGGCTTACGCCCATATGGGCTGGATC
CCTCTGGTTCGAGACTGGGGCGGCAACAACCTGGCGGTCGACTTGGCGCCGGGGCCCAACGGTCGCTGGGGTCAG
ATCATTCTGTTCGGCCGCGACTATGACACCAAATACGTCGTGGCCCGCTCTTGGGCAGCCTTTCTGGCCCTCGTT
GCCGACGACCTCAATAGCGGCAAGTGGTTCGTCGACGACGAAACCGGCGAGCTCAAACTGAGGGAGTTTAAGGAG
ACGCGGGTTGAGCCGGCCTACTTTTCCATTCTGCGATGGAGGATGGACCAGAAGCACGGGCGGAGGGCGGCCAAG
CGGGCATCGATGGCGCCGACCAAGACGGGCTCGCCCCTGGCCTCGCGGTCGGCCTCGCCCTATGCCAGTCCGACG
GAGCTCAATGGCGACGTGCGGGGGAGAACGGCGCAGCGGTTGAGCGGCTCGTCTCCGCTCTCGAGCCCGATGAAC
CCGCCGGCATACCTGAAGCCGCTGCCACTCAGCCGGGTGACGGAGGAGATGTCGATTCCGGAGATGCCGAGCGCC
TTCATCGAGCCCAGTCAACTGGTCGAGGTGGAGACGCTGGACGACATGGATCGGGGCAAGAATGCGCTGCGCATC
TCGACTGTTGCCTGCGCCGACTCGGACGAAATGCTGTCGAGCAAGGTCAACGGAAAGCAGCCTGCCATGGGAGAT
GGCGTTCTCAAGACGATTGAGATTTGA
Gene >Ophcf2|05845
ATGGAGAGCTCCGGGTAAGCATCGTGTCCCCCCCCCAAAGTTGGTCGTCGTTGGCTAATCGTCGATGCCTTCAGC
TTCGGTTCCGCCCTGCGCTCCTTCTGGCACACCATGACCAGCTACGATCGACGTAAGCCTGCCTCAGTGCCCCTG
GGACGCGTCGAGAAGCTAACAAACCTGCATGACAGACTCCTCATATCACTCCCCGCACAGGACCGGCCGCCATGT
CCCTCTGCAAAATAATCGCGTCGGCATTCTCACGGGCGTTGCGACCGCCTCCGACTCTCACGCCGATGTCAGCTA
CCCATACTCAGACGATGGCGGACGCTCCTCGCCCCCAGCCGCCCGCGGTTCATACTCTCCCGGCATGCGATCCGC
CGCCGTCAAGCAGTCGGACGGTTTTGAGGTCCAGAGCCCGGGCGACGTGCCCATGCAATCATTCAGTGATGGACT
GCCGCCCCCGCCCCCCGTTAGCCACTCGTGGAAGCGCATAGATGCCTGGGCCGAAGACAACTACCCGGAACTGTT
CGATCAACTGTGCGAGGGCGCCACCACCAACGATCTCAACGATCTCGAGCATCAGCTCGACTGCTCTCTCCCTCA
AGACATCCGCGAGTCTCTTGCCATCCACGACGGCCAGGAGCGAGGCGGTAATCCGACGGGAATCATCTTCAGCTC
CATGCTGTTGGACTGCGAGGAGATTGTCCAAGAATGGGAGACGTGGCGTACGGTCAACCAGCAGCTGCTGATTGA
TGCCGCCAACGCGACGCCCGCGACGCCCTCGAAGCTCTCAGCCGGCAGCAACGAAGCCTCCTCATCGCGACAGCG
GCCCCTGTCATCGTCGTCGGCCAGCACGAGCGACGAGTGGCGTCAGAGCCTGTTGGCCCGCCAGGACTCGGTCCC
GCCCAAGGCGGTGCAGAGGGCTTACGCCCATATGGGCTGGATCCCTCTGGTTCGAGACTGGGGCGGCAACAACCT
GGCGGTCGACTTGGCGCCGGGGCCCAACGGTCGCTGGGGTCAGATCATTCTGTTCGGCCGCGACTATGACACCAA
ATACGTCGTGGCCCGCTCTTGGGCAGCCTTTCTGGCCCTCGTTGCCGACGACCTCAATAGCGGCAAGTGGTTCGT
CGACGACGAAACCGGCGAGCTCAAACTGAGGGAGTTTAAGGAGACGCGGGTTGAGCCGGCCTACTTTTCCATTCT
GCGATGGAGGATGGACCAGAAGCACGGGCGGAGGGCGGCCAAGCGGGCATCGATGGCGCCGACCAAGACGGGCTC
GCCCCTGGCCTCGCGGTCGGCCTCGCCCTATGCCAGTCCGACGGAGCTCAATGGCGACGTGCGGGGGAGAACGGC
GCAGCGGTTGAGCGGCTCGTCTCCGCTCTCGAGCCCGATGAACCCGCCGGCATACCTGAAGCCGCTGCCACTCAG
CCGGGTGACGGAGGAGATGTCGATTCCGGAGATGCCGAGCGCCTTCATCGAGCCCAGTCAACTGGTCGAGGTGGA
GACGCTGGACGACATGGATCGGGGCAAGAATGCGCTGCGCATCTCGACTGTTGCCTGCGCCGACTCGGACGAAAT
GCTGTCGAGCAAGGTCAACGGAAAGCAGCCTGCCATGGGAGATGGCGTTCTCAAGACGATTGAGATTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail