Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05842
Gene name
Locationscaffold_06:2396562..2399979
Strand-
Gene length (bp)3417
Transcript length (bp)3417
Coding sequence length (bp)3417
Protein length (aa) 1139

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08634 Pet127 Mitochondrial protein Pet127 9.1E-116 234 505

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0000959 mitochondrial RNA metabolic process Yes
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0046483 heterocycle metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0043229 intracellular organelle No
GO:0016070 RNA metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0008150 biological_process No
GO:0043226 organelle No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4346 0.4535 0.1299 0.052 0.2641 0.3263 0.1427 0.065 0.3458 0.0028

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3417
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4012
Ophiocordyceps australis map64 (Brazil) OphauB2|1380
Ophiocordyceps camponoti-floridani Ophcf2|05842 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|651
Ophiocordyceps kimflemingae Ophio5|4174
Ophiocordyceps subramaniannii Hirsu2|6436

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05842
MSLTEFFNRVKSSPEAQKKYDDNENESGGHWTIAMAGRMRELRKPVGEYKDKRTEGDDHFSKKSSSTYQEYSQSA
ESELKKPAQLSSLSKKGSQSTPKKTNLPTAKKGGFSTTKRTTSSTTKKAASSTTKKSASSSTKKTVGKKKSTTST
EAKSGAKKNPVNIEVLDSKAVEFTPILGKCSKKIPDLSYDLDRVLFNQGVYHMQDERTGVFNFDPYLASIMPRDE
FDFTALGDYITSSKDVKLREMAAEFGMKFCGSTSSLSSILSQFHFLLSAWRPVSYTVLSKSLKPESSKFTTFTRA
PAAAFARYKDGVYAIDADKEYDVESILSMLGKSMEKLLTLPKEEFERYRRTKSHQISEEERNAGEAYHYATIRNF
LVRSQLDAQDKRLPGTGVFDLKTRAVISIRMDVQGYEKGLGYEIRKRFGDWESFEREYYDMIRSAFLKYSLQVRM
GRMDGIFVAFHNTERIFGFQYVSLPEMDQAIHGTDDVRLGDQEFRLSFGLFNELLERATKRFPNQSLRFIVETRE
TKVPLTYFFAEPVTEEEADRIQAASRPSVEQLKDEVNRNLEASEARDGMEESRTEEMGESRAEDEANDDDGAVAS
DARSDDAWKELMARVDDIIENDSQGIGSVRDAVLEALENCGLSQALTEREGARYLDHLVTAVTAHLTKSEETETS
AEAEESPESQEEETTKSEETETSAEAEESPESQEEETSAESEELSEENPTEPEETSKAEEAELRTEPNDFTETRE
KETSGEQDAQKGISQAQESQEEPHEPWVKEGLTKRLYVQRLMENVRDKYAEDVWEAKVEELTKSLESRGATMPDE
LVQAETSSKMDEEGSSRQMQESEGEAAEEEKSVETEQTKLAKLILEARTATDEGEQRAELLKRIFNDLATQSKRW
QQARETNAEESDGASVEERSAKDSDDEGDGVIADDVGEASPTSDETASTHETGSGSADDGSKVAEASAMEQTART
KEPAEQAKEKTPEEKGEEQTAEKTPEEIEASRPVMGMYVTIRNKVNGLYVERPSCSQTVKDWSIEYSINEMDTGK
ARQIYREIKTRRKKIHNSQDPELRAQEWYRMFGGKLSELSQKGRDYRARKMREEAGNPIQVVWAKEPLSLAELGL
AEPVSDAGGEGTK*
Coding >Ophcf2|05842
ATGTCTCTGACTGAGTTCTTCAATCGCGTCAAAAGCTCCCCCGAAGCCCAAAAGAAATACGATGACAACGAGAAC
GAATCCGGCGGCCATTGGACCATAGCCATGGCGGGGAGAATGCGAGAGCTCAGGAAGCCTGTTGGAGAGTACAAA
GACAAGAGAACGGAAGGCGACGACCACTTTTCCAAGAAATCTTCATCCACTTATCAGGAGTACTCCCAATCAGCT
GAATCTGAGTTGAAGAAACCTGCGCAACTGTCTTCGCTGTCCAAGAAGGGCAGTCAGTCCACACCGAAAAAGACT
AACCTCCCGACGGCAAAAAAGGGGGGCTTCTCAACGACGAAGAGGACGACTTCTTCGACTACAAAAAAGGCCGCT
TCTTCGACGACTAAAAAATCCGCCTCTTCGTCAACCAAAAAGACCGTTGGGAAGAAGAAATCCACAACTTCTACC
GAGGCCAAATCAGGGGCAAAAAAGAACCCAGTCAATATCGAGGTTCTCGATTCCAAGGCAGTTGAATTTACTCCT
ATCCTCGGGAAGTGCTCTAAAAAAATTCCGGATCTATCTTATGACTTGGATCGTGTCCTGTTCAATCAGGGGGTT
TACCACATGCAAGACGAACGAACCGGGGTCTTCAACTTTGACCCCTACCTGGCCTCCATCATGCCTAGAGACGAG
TTTGACTTTACGGCCCTCGGCGACTACATCACCTCGTCCAAGGATGTCAAGCTTCGAGAGATGGCCGCCGAGTTC
GGCATGAAGTTTTGCGGTTCCACGTCGAGTCTGTCGTCAATTCTGTCCCAATTTCACTTCCTCCTTTCCGCCTGG
AGACCTGTATCCTACACAGTTCTTTCGAAATCCCTCAAGCCCGAGTCGAGCAAGTTCACAACCTTTACTCGGGCG
CCAGCTGCGGCTTTTGCAAGGTACAAGGACGGTGTTTACGCCATCGATGCTGACAAGGAGTACGATGTGGAGAGC
ATCTTGAGCATGCTGGGAAAGTCGATGGAGAAGCTGCTGACGCTGCCGAAGGAGGAGTTTGAGAGGTATCGAAGA
ACCAAGTCTCACCAGATATCGGAGGAGGAGAGAAATGCCGGAGAAGCCTATCACTATGCCACCATTCGCAACTTT
CTTGTGCGTTCACAGCTCGATGCACAAGACAAGCGACTGCCAGGGACGGGTGTCTTTGATCTGAAAACAAGAGCC
GTCATTTCCATCCGCATGGATGTTCAGGGCTACGAGAAGGGCCTCGGCTACGAAATACGCAAGCGCTTCGGAGAC
TGGGAGTCCTTTGAGCGCGAATATTACGACATGATTCGGTCTGCCTTTTTAAAATATTCGCTGCAGGTTCGGATG
GGGCGAATGGATGGCATCTTTGTGGCCTTTCATAACACGGAGCGCATCTTTGGCTTCCAGTACGTCAGCCTGCCA
GAGATGGACCAGGCTATCCATGGGACAGACGACGTGCGACTCGGTGATCAGGAGTTCAGGCTCAGTTTCGGGCTG
TTCAACGAGCTGCTGGAGCGGGCGACGAAGCGCTTCCCCAACCAGTCTCTAAGGTTCATCGTGGAGACGCGCGAA
ACCAAGGTTCCCCTCACCTACTTTTTCGCCGAGCCTGTGACGGAAGAGGAGGCGGACCGGATCCAGGCAGCGTCT
CGGCCATCGGTTGAGCAACTCAAGGATGAGGTCAACCGTAATCTCGAGGCGAGCGAGGCCCGAGACGGCATGGAG
GAGAGTCGGACTGAGGAGATGGGAGAATCGCGCGCCGAAGATGAGGCGAATGACGACGATGGAGCCGTGGCCAGT
GACGCTCGAAGCGACGACGCATGGAAGGAGTTGATGGCGAGGGTGGATGATATCATCGAGAACGACTCACAGGGC
ATCGGCTCCGTGCGAGATGCCGTCCTGGAAGCTCTGGAAAACTGCGGACTATCTCAAGCTCTGACGGAACGCGAG
GGGGCGAGGTACCTGGATCACCTGGTGACGGCGGTCACCGCCCACTTGACCAAGTCTGAGGAGACAGAGACGTCG
GCTGAGGCGGAGGAGTCCCCTGAGTCTCAAGAAGAAGAAACGACCAAGTCCGAGGAAACAGAGACGTCGGCTGAG
GCGGAGGAGTCCCCCGAGTCTCAAGAAGAAGAAACGTCGGCCGAGTCAGAAGAATTGAGTGAAGAGAATCCGACC
GAGCCAGAAGAAACAAGCAAGGCTGAGGAAGCAGAGCTGCGTACTGAACCGAATGATTTCACCGAGACTCGAGAA
AAGGAGACTTCGGGTGAGCAAGACGCGCAGAAAGGCATTTCCCAGGCCCAGGAGTCACAAGAGGAACCGCACGAG
CCCTGGGTAAAGGAAGGGCTGACGAAAAGACTTTACGTGCAACGGCTGATGGAGAATGTGCGGGATAAGTATGCG
GAAGACGTTTGGGAGGCCAAAGTGGAGGAGTTGACCAAGTCTCTGGAGAGCAGAGGAGCGACGATGCCTGATGAA
CTTGTTCAGGCGGAGACGTCGTCCAAGATGGACGAGGAGGGCAGCAGTAGACAGATGCAAGAATCGGAAGGGGAG
GCGGCGGAAGAGGAGAAATCGGTCGAGACGGAGCAGACGAAACTGGCCAAACTGATACTCGAGGCACGCACAGCG
ACCGATGAAGGGGAGCAGAGAGCGGAACTGCTCAAACGCATATTCAACGACTTGGCAACGCAATCCAAACGATGG
CAACAGGCACGAGAAACGAATGCGGAAGAGAGCGACGGCGCCAGCGTGGAAGAGCGCAGTGCAAAGGATAGCGAC
GACGAAGGCGACGGTGTCATTGCCGATGATGTTGGAGAGGCATCCCCCACAAGCGACGAGACGGCAAGTACCCAT
GAGACCGGAAGTGGAAGCGCCGACGATGGCTCCAAGGTTGCAGAGGCGTCGGCGATGGAGCAGACAGCGCGAACA
AAAGAGCCAGCAGAGCAGGCGAAGGAGAAGACCCCGGAGGAGAAGGGAGAGGAGCAGACGGCGGAGAAGACCCCG
GAAGAGATAGAAGCATCCCGGCCGGTGATGGGGATGTACGTGACGATCCGCAACAAAGTCAACGGTCTGTACGTT
GAGCGGCCCTCGTGCAGTCAGACGGTGAAAGACTGGAGCATCGAGTATTCTATCAACGAGATGGACACCGGGAAA
GCGCGACAAATCTACAGGGAGATCAAGACACGGCGGAAGAAGATCCACAACAGCCAAGACCCCGAGTTGAGAGCG
CAAGAGTGGTACAGGATGTTTGGAGGGAAGCTGTCGGAACTGTCTCAGAAGGGACGGGATTACCGGGCCAGGAAG
ATGCGGGAAGAGGCGGGCAACCCGATTCAGGTGGTATGGGCCAAGGAACCTCTGAGTCTGGCCGAACTGGGACTC
GCAGAGCCGGTGTCCGATGCAGGTGGAGAGGGAACGAAATGA
Transcript >Ophcf2|05842
ATGTCTCTGACTGAGTTCTTCAATCGCGTCAAAAGCTCCCCCGAAGCCCAAAAGAAATACGATGACAACGAGAAC
GAATCCGGCGGCCATTGGACCATAGCCATGGCGGGGAGAATGCGAGAGCTCAGGAAGCCTGTTGGAGAGTACAAA
GACAAGAGAACGGAAGGCGACGACCACTTTTCCAAGAAATCTTCATCCACTTATCAGGAGTACTCCCAATCAGCT
GAATCTGAGTTGAAGAAACCTGCGCAACTGTCTTCGCTGTCCAAGAAGGGCAGTCAGTCCACACCGAAAAAGACT
AACCTCCCGACGGCAAAAAAGGGGGGCTTCTCAACGACGAAGAGGACGACTTCTTCGACTACAAAAAAGGCCGCT
TCTTCGACGACTAAAAAATCCGCCTCTTCGTCAACCAAAAAGACCGTTGGGAAGAAGAAATCCACAACTTCTACC
GAGGCCAAATCAGGGGCAAAAAAGAACCCAGTCAATATCGAGGTTCTCGATTCCAAGGCAGTTGAATTTACTCCT
ATCCTCGGGAAGTGCTCTAAAAAAATTCCGGATCTATCTTATGACTTGGATCGTGTCCTGTTCAATCAGGGGGTT
TACCACATGCAAGACGAACGAACCGGGGTCTTCAACTTTGACCCCTACCTGGCCTCCATCATGCCTAGAGACGAG
TTTGACTTTACGGCCCTCGGCGACTACATCACCTCGTCCAAGGATGTCAAGCTTCGAGAGATGGCCGCCGAGTTC
GGCATGAAGTTTTGCGGTTCCACGTCGAGTCTGTCGTCAATTCTGTCCCAATTTCACTTCCTCCTTTCCGCCTGG
AGACCTGTATCCTACACAGTTCTTTCGAAATCCCTCAAGCCCGAGTCGAGCAAGTTCACAACCTTTACTCGGGCG
CCAGCTGCGGCTTTTGCAAGGTACAAGGACGGTGTTTACGCCATCGATGCTGACAAGGAGTACGATGTGGAGAGC
ATCTTGAGCATGCTGGGAAAGTCGATGGAGAAGCTGCTGACGCTGCCGAAGGAGGAGTTTGAGAGGTATCGAAGA
ACCAAGTCTCACCAGATATCGGAGGAGGAGAGAAATGCCGGAGAAGCCTATCACTATGCCACCATTCGCAACTTT
CTTGTGCGTTCACAGCTCGATGCACAAGACAAGCGACTGCCAGGGACGGGTGTCTTTGATCTGAAAACAAGAGCC
GTCATTTCCATCCGCATGGATGTTCAGGGCTACGAGAAGGGCCTCGGCTACGAAATACGCAAGCGCTTCGGAGAC
TGGGAGTCCTTTGAGCGCGAATATTACGACATGATTCGGTCTGCCTTTTTAAAATATTCGCTGCAGGTTCGGATG
GGGCGAATGGATGGCATCTTTGTGGCCTTTCATAACACGGAGCGCATCTTTGGCTTCCAGTACGTCAGCCTGCCA
GAGATGGACCAGGCTATCCATGGGACAGACGACGTGCGACTCGGTGATCAGGAGTTCAGGCTCAGTTTCGGGCTG
TTCAACGAGCTGCTGGAGCGGGCGACGAAGCGCTTCCCCAACCAGTCTCTAAGGTTCATCGTGGAGACGCGCGAA
ACCAAGGTTCCCCTCACCTACTTTTTCGCCGAGCCTGTGACGGAAGAGGAGGCGGACCGGATCCAGGCAGCGTCT
CGGCCATCGGTTGAGCAACTCAAGGATGAGGTCAACCGTAATCTCGAGGCGAGCGAGGCCCGAGACGGCATGGAG
GAGAGTCGGACTGAGGAGATGGGAGAATCGCGCGCCGAAGATGAGGCGAATGACGACGATGGAGCCGTGGCCAGT
GACGCTCGAAGCGACGACGCATGGAAGGAGTTGATGGCGAGGGTGGATGATATCATCGAGAACGACTCACAGGGC
ATCGGCTCCGTGCGAGATGCCGTCCTGGAAGCTCTGGAAAACTGCGGACTATCTCAAGCTCTGACGGAACGCGAG
GGGGCGAGGTACCTGGATCACCTGGTGACGGCGGTCACCGCCCACTTGACCAAGTCTGAGGAGACAGAGACGTCG
GCTGAGGCGGAGGAGTCCCCTGAGTCTCAAGAAGAAGAAACGACCAAGTCCGAGGAAACAGAGACGTCGGCTGAG
GCGGAGGAGTCCCCCGAGTCTCAAGAAGAAGAAACGTCGGCCGAGTCAGAAGAATTGAGTGAAGAGAATCCGACC
GAGCCAGAAGAAACAAGCAAGGCTGAGGAAGCAGAGCTGCGTACTGAACCGAATGATTTCACCGAGACTCGAGAA
AAGGAGACTTCGGGTGAGCAAGACGCGCAGAAAGGCATTTCCCAGGCCCAGGAGTCACAAGAGGAACCGCACGAG
CCCTGGGTAAAGGAAGGGCTGACGAAAAGACTTTACGTGCAACGGCTGATGGAGAATGTGCGGGATAAGTATGCG
GAAGACGTTTGGGAGGCCAAAGTGGAGGAGTTGACCAAGTCTCTGGAGAGCAGAGGAGCGACGATGCCTGATGAA
CTTGTTCAGGCGGAGACGTCGTCCAAGATGGACGAGGAGGGCAGCAGTAGACAGATGCAAGAATCGGAAGGGGAG
GCGGCGGAAGAGGAGAAATCGGTCGAGACGGAGCAGACGAAACTGGCCAAACTGATACTCGAGGCACGCACAGCG
ACCGATGAAGGGGAGCAGAGAGCGGAACTGCTCAAACGCATATTCAACGACTTGGCAACGCAATCCAAACGATGG
CAACAGGCACGAGAAACGAATGCGGAAGAGAGCGACGGCGCCAGCGTGGAAGAGCGCAGTGCAAAGGATAGCGAC
GACGAAGGCGACGGTGTCATTGCCGATGATGTTGGAGAGGCATCCCCCACAAGCGACGAGACGGCAAGTACCCAT
GAGACCGGAAGTGGAAGCGCCGACGATGGCTCCAAGGTTGCAGAGGCGTCGGCGATGGAGCAGACAGCGCGAACA
AAAGAGCCAGCAGAGCAGGCGAAGGAGAAGACCCCGGAGGAGAAGGGAGAGGAGCAGACGGCGGAGAAGACCCCG
GAAGAGATAGAAGCATCCCGGCCGGTGATGGGGATGTACGTGACGATCCGCAACAAAGTCAACGGTCTGTACGTT
GAGCGGCCCTCGTGCAGTCAGACGGTGAAAGACTGGAGCATCGAGTATTCTATCAACGAGATGGACACCGGGAAA
GCGCGACAAATCTACAGGGAGATCAAGACACGGCGGAAGAAGATCCACAACAGCCAAGACCCCGAGTTGAGAGCG
CAAGAGTGGTACAGGATGTTTGGAGGGAAGCTGTCGGAACTGTCTCAGAAGGGACGGGATTACCGGGCCAGGAAG
ATGCGGGAAGAGGCGGGCAACCCGATTCAGGTGGTATGGGCCAAGGAACCTCTGAGTCTGGCCGAACTGGGACTC
GCAGAGCCGGTGTCCGATGCAGGTGGAGAGGGAACGAAATGA
Gene >Ophcf2|05842
ATGTCTCTGACTGAGTTCTTCAATCGCGTCAAAAGCTCCCCCGAAGCCCAAAAGAAATACGATGACAACGAGAAC
GAATCCGGCGGCCATTGGACCATAGCCATGGCGGGGAGAATGCGAGAGCTCAGGAAGCCTGTTGGAGAGTACAAA
GACAAGAGAACGGAAGGCGACGACCACTTTTCCAAGAAATCTTCATCCACTTATCAGGAGTACTCCCAATCAGCT
GAATCTGAGTTGAAGAAACCTGCGCAACTGTCTTCGCTGTCCAAGAAGGGCAGTCAGTCCACACCGAAAAAGACT
AACCTCCCGACGGCAAAAAAGGGGGGCTTCTCAACGACGAAGAGGACGACTTCTTCGACTACAAAAAAGGCCGCT
TCTTCGACGACTAAAAAATCCGCCTCTTCGTCAACCAAAAAGACCGTTGGGAAGAAGAAATCCACAACTTCTACC
GAGGCCAAATCAGGGGCAAAAAAGAACCCAGTCAATATCGAGGTTCTCGATTCCAAGGCAGTTGAATTTACTCCT
ATCCTCGGGAAGTGCTCTAAAAAAATTCCGGATCTATCTTATGACTTGGATCGTGTCCTGTTCAATCAGGGGGTT
TACCACATGCAAGACGAACGAACCGGGGTCTTCAACTTTGACCCCTACCTGGCCTCCATCATGCCTAGAGACGAG
TTTGACTTTACGGCCCTCGGCGACTACATCACCTCGTCCAAGGATGTCAAGCTTCGAGAGATGGCCGCCGAGTTC
GGCATGAAGTTTTGCGGTTCCACGTCGAGTCTGTCGTCAATTCTGTCCCAATTTCACTTCCTCCTTTCCGCCTGG
AGACCTGTATCCTACACAGTTCTTTCGAAATCCCTCAAGCCCGAGTCGAGCAAGTTCACAACCTTTACTCGGGCG
CCAGCTGCGGCTTTTGCAAGGTACAAGGACGGTGTTTACGCCATCGATGCTGACAAGGAGTACGATGTGGAGAGC
ATCTTGAGCATGCTGGGAAAGTCGATGGAGAAGCTGCTGACGCTGCCGAAGGAGGAGTTTGAGAGGTATCGAAGA
ACCAAGTCTCACCAGATATCGGAGGAGGAGAGAAATGCCGGAGAAGCCTATCACTATGCCACCATTCGCAACTTT
CTTGTGCGTTCACAGCTCGATGCACAAGACAAGCGACTGCCAGGGACGGGTGTCTTTGATCTGAAAACAAGAGCC
GTCATTTCCATCCGCATGGATGTTCAGGGCTACGAGAAGGGCCTCGGCTACGAAATACGCAAGCGCTTCGGAGAC
TGGGAGTCCTTTGAGCGCGAATATTACGACATGATTCGGTCTGCCTTTTTAAAATATTCGCTGCAGGTTCGGATG
GGGCGAATGGATGGCATCTTTGTGGCCTTTCATAACACGGAGCGCATCTTTGGCTTCCAGTACGTCAGCCTGCCA
GAGATGGACCAGGCTATCCATGGGACAGACGACGTGCGACTCGGTGATCAGGAGTTCAGGCTCAGTTTCGGGCTG
TTCAACGAGCTGCTGGAGCGGGCGACGAAGCGCTTCCCCAACCAGTCTCTAAGGTTCATCGTGGAGACGCGCGAA
ACCAAGGTTCCCCTCACCTACTTTTTCGCCGAGCCTGTGACGGAAGAGGAGGCGGACCGGATCCAGGCAGCGTCT
CGGCCATCGGTTGAGCAACTCAAGGATGAGGTCAACCGTAATCTCGAGGCGAGCGAGGCCCGAGACGGCATGGAG
GAGAGTCGGACTGAGGAGATGGGAGAATCGCGCGCCGAAGATGAGGCGAATGACGACGATGGAGCCGTGGCCAGT
GACGCTCGAAGCGACGACGCATGGAAGGAGTTGATGGCGAGGGTGGATGATATCATCGAGAACGACTCACAGGGC
ATCGGCTCCGTGCGAGATGCCGTCCTGGAAGCTCTGGAAAACTGCGGACTATCTCAAGCTCTGACGGAACGCGAG
GGGGCGAGGTACCTGGATCACCTGGTGACGGCGGTCACCGCCCACTTGACCAAGTCTGAGGAGACAGAGACGTCG
GCTGAGGCGGAGGAGTCCCCTGAGTCTCAAGAAGAAGAAACGACCAAGTCCGAGGAAACAGAGACGTCGGCTGAG
GCGGAGGAGTCCCCCGAGTCTCAAGAAGAAGAAACGTCGGCCGAGTCAGAAGAATTGAGTGAAGAGAATCCGACC
GAGCCAGAAGAAACAAGCAAGGCTGAGGAAGCAGAGCTGCGTACTGAACCGAATGATTTCACCGAGACTCGAGAA
AAGGAGACTTCGGGTGAGCAAGACGCGCAGAAAGGCATTTCCCAGGCCCAGGAGTCACAAGAGGAACCGCACGAG
CCCTGGGTAAAGGAAGGGCTGACGAAAAGACTTTACGTGCAACGGCTGATGGAGAATGTGCGGGATAAGTATGCG
GAAGACGTTTGGGAGGCCAAAGTGGAGGAGTTGACCAAGTCTCTGGAGAGCAGAGGAGCGACGATGCCTGATGAA
CTTGTTCAGGCGGAGACGTCGTCCAAGATGGACGAGGAGGGCAGCAGTAGACAGATGCAAGAATCGGAAGGGGAG
GCGGCGGAAGAGGAGAAATCGGTCGAGACGGAGCAGACGAAACTGGCCAAACTGATACTCGAGGCACGCACAGCG
ACCGATGAAGGGGAGCAGAGAGCGGAACTGCTCAAACGCATATTCAACGACTTGGCAACGCAATCCAAACGATGG
CAACAGGCACGAGAAACGAATGCGGAAGAGAGCGACGGCGCCAGCGTGGAAGAGCGCAGTGCAAAGGATAGCGAC
GACGAAGGCGACGGTGTCATTGCCGATGATGTTGGAGAGGCATCCCCCACAAGCGACGAGACGGCAAGTACCCAT
GAGACCGGAAGTGGAAGCGCCGACGATGGCTCCAAGGTTGCAGAGGCGTCGGCGATGGAGCAGACAGCGCGAACA
AAAGAGCCAGCAGAGCAGGCGAAGGAGAAGACCCCGGAGGAGAAGGGAGAGGAGCAGACGGCGGAGAAGACCCCG
GAAGAGATAGAAGCATCCCGGCCGGTGATGGGGATGTACGTGACGATCCGCAACAAAGTCAACGGTCTGTACGTT
GAGCGGCCCTCGTGCAGTCAGACGGTGAAAGACTGGAGCATCGAGTATTCTATCAACGAGATGGACACCGGGAAA
GCGCGACAAATCTACAGGGAGATCAAGACACGGCGGAAGAAGATCCACAACAGCCAAGACCCCGAGTTGAGAGCG
CAAGAGTGGTACAGGATGTTTGGAGGGAAGCTGTCGGAACTGTCTCAGAAGGGACGGGATTACCGGGCCAGGAAG
ATGCGGGAAGAGGCGGGCAACCCGATTCAGGTGGTATGGGCCAAGGAACCTCTGAGTCTGGCCGAACTGGGACTC
GCAGAGCCGGTGTCCGATGCAGGTGGAGAGGGAACGAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail